PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G117400.2.p
Common NameSb05g017130, SORBIDRAFT_05g017130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 226aa    MW: 24240.3 Da    PI: 9.4548
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G117400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.6e-33133191159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+
  Sobic.005G117400.2.p 133 LDDGYRWRKYGQKAVKNNNFPRSYYRCTHQGCNVKKQVQRLSRDEGVVVTTYEGTHTHP 191
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-34118191IPR003657WRKY domain
SuperFamilySSF1182907.32E-30125192IPR003657WRKY domain
PROSITE profilePS5081130.113128193IPR003657WRKY domain
SMARTSM007741.1E-39133192IPR003657WRKY domain
PfamPF031063.6E-27134191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MENYHMLFGA ASTHASSAAT PSSYNFMATA AGTSGGGGGG FHDHDRGQRS SGHGGGGSSS  60
SFFAELSSNN DDSKEYGGAS SPPGPAAGSG RGESSVGPAA AAGEVDRPPK RKGEKKERRP  120
RYAFQTRSQV DILDDGYRWR KYGQKAVKNN NFPRSYYRCT HQGCNVKKQV QRLSRDEGVV  180
VTTYEGTHTH PIEKSNDNFE HILTQMQIYS GMGSTFSSSS HNMFH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-27124192876Probable WRKY transcription factor 4
2lex_A2e-27124192876Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7282001e-156KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449513.11e-168hypothetical protein SORBIDRAFT_05g017130
TrEMBLC5Y2H71e-167C5Y2H7_SORBI; Putative uncharacterized protein Sb05g017130
STRINGSb05g017130.11e-167(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-55WRKY DNA-binding protein 75