PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G073500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family B3
Protein Properties Length: 481aa    MW: 53520.5 Da    PI: 9.6416
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G073500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3543.1e-1796185198
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                           ffkv+ p   l+  rl +p  f ++ +++++++  ++l+ +sg++W+ +l     s++ ++++GWkeFv ++ ++ g f+vF++dg s+
  Sobic.005G073500.2.p  96 FFKVFFP--ELSGERLKIPPMFRQHLQEQPTGP--VSLRGPSGKKWQATL--ASESEAWFFEQGWKEFVTDHSINKGYFLVFTYDGPSQ 178
                           7788844..566678******975559999998..***************..99999****************************9999 PP

                           E..EEEEE- CS
                    B3  90 felvvkvfr 98 
                           f   v vf+
  Sobic.005G073500.2.p 179 F--SVVVFS 185
                           9..666665 PP

2B341.72.1e-13374465398
                           EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                    B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                           ++++ s+v     + +  +f+++   + +++k++tl d+ g+ Wev++ y   ++   +++GW +F+  n+L+  D+++F+l ++   +
  Sobic.005G073500.2.p 374 QIMMESYVYVGFFMNIACDFVRKSL-P-HTNKKMTLWDPLGKPWEVNYVYYSDRSVGSFSGGWGKFALGNNLEKFDVCIFELFKE--DN 458
                           678999999999999999***8774.3.46679***************995555556799*********************8764..44 PP

                           .EEEEE- CS
                    B3  92 lvvkvfr 98 
                            +v+++r
  Sobic.005G073500.2.p 459 IKVHIYR 465
                           5788776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.3894187IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-1994188IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.0E-2094188IPR015300DNA-binding pseudobarrel domain
CDDcd100176.67E-1894185No hitNo description
SMARTSM010195.5E-1396187IPR003340B3 DNA binding domain
PfamPF023621.9E-1496184IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.9E-22364465IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-22365465IPR015300DNA-binding pseudobarrel domain
CDDcd100173.13E-22370465No hitNo description
PROSITE profilePS5086312.012372467IPR003340B3 DNA binding domain
SMARTSM010194.2E-9372467IPR003340B3 DNA binding domain
PfamPF023622.2E-11374465IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MRGRPKKQQG TTSSAAAAVK EREAARGRPR SKGKETEMGG EGQEPATEKQ KKTQGKGMEK  60
EKEKEKNTAV REDGEQDDNN EKEKTAAGAG NVCPQFFKVF FPELSGERLK IPPMFRQHLQ  120
EQPTGPVSLR GPSGKKWQAT LASESEAWFF EQGWKEFVTD HSINKGYFLV FTYDGPSQFS  180
VVVFSPSGVT DPIALKAKPT NEVVVKIEED EEGIQGDMDA GGASEVPIPP TQEGNVVTGR  240
RTRAMTAGAS EIPPLPTEEG NVVTGKRTRA VTDLPADADA SKRIQADKRR SQAGTSKDGL  300
TIVRNATFSL LDESKTFNKT QVRDKNVPRS GKFLLKTSRA PVVISQRRPV TEEERDLALR  360
KANEFKSKYP FTVQIMMESY VYVGFFMNIA CDFVRKSLPH TNKKMTLWDP LGKPWEVNYV  420
YYSDRSVGSF SGGWGKFALG NNLEKFDVCI FELFKEDNIK VHIYRVVPEI TPLLRASNKD  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-1134546622142B3 domain-containing transcription factor VRN1
4i1k_B3e-1134546622142B3 domain-containing transcription factor VRN1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G073500.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021316377.10.0B3 domain-containing protein Os11g0197600 isoform X1
RefseqXP_021316378.10.0B3 domain-containing protein Os11g0197600 isoform X1
SwissprotQ2R9D21e-126Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A1B6PQP90.0A0A1B6PQP9_SORBI; Uncharacterized protein
STRINGSb05g006090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.16e-16B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]