PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G046250.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 968aa    MW: 107470 Da    PI: 6.1191
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G046250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS210.97.1e-651024562364
                  GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                            +lLl+ A+av++gd +la a+L++l+ l      + + +++ Rla +f+++L++r+++++s +y    p       +s  ++a+++ +
  Sobic.005G046250.1.p 102 SDLLLTGADAVEAGDSSLALAVLSKLNSLladtcENAATSSFGRLAYHFAQGLQSRMSGTCSPCYPPADPV------QSGIMSAHQMIQ 184
                           689************************99765533444479******************777777444444......556889999*** PP

                  GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgv 174
                           e+sP++kf+h+taNqaIl+a+ ++  +H++Df+++ G+QWp+L+  La    g  s+ +T++   +  s ++ ++ ++rL++fAe+l++
  Sobic.005G046250.1.p 185 ELSPYVKFAHFTANQAILDATISDMDIHVVDFNLGDGIQWPSLMSDLARL--GGKSFHLTAIITDAGYSDDTHQAAARRLSEFAESLNL 271
                           ************************************************75..557999******7777********************* PP

                  GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse......sFler 256
                           pf+++ l  ++ ed  le+++ + g +++V++     +l  +s+s  +    +L +v++l+Pk vvv+e+e+ + ++e      sF+e 
  Sobic.005G046250.1.p 272 PFQYSSLCIRHEED--LEDFSRNCGGSVVVSCDT--TNLCYRSGSKLQ--MLLLGCVRKLQPKSVVVIEEELVRiGKEaclsqaSFVEF 354
                           ******97775555..59999999********98..556556666655..699*****************95443444555555***** PP

                  GRAS 257 flealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                           f+eal++++++f+sl++ ++++    + vE+e++g++i++ v + g+      e ++   ++    GFk+ +ls  +++qa++l++ ++
  Sobic.005G046250.1.p 355 FFEALHHFTMVFESLSSCFSSNRACLRLVEKEMMGPKIQDFVGQYGSV---TLEGAAGDPKA--LEGFKSCELSACNVAQARMLVALFN 438
                           ***********************************************9...44544444455..56*********************** PP

                  GRAS 346 sdgyrveeesgslvlgWkd 364
                            + +   +++g l l+Wk+
  Sobic.005G046250.1.p 439 -RSFGTAHQKGRLQLCWKS 456
                           .66**************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.49575447IPR005202Transcription factor GRAS
PfamPF035142.4E-62102456IPR005202Transcription factor GRAS
SuperFamilySSF525403.9E-21633857IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009313.2E-6727849IPR002182NB-ARC
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043531Molecular FunctionADP binding
Sequence ? help Back to Top
Protein Sequence    Length: 968 aa     Download sequence    Send to blast
METISYPCSP LLFFPAHEES TCSLWSPQLT LHENAAIPAN PSPVVREDCE FFDTIAIDSS  60
DSHDQHAFDV DVFTHCDERF LCQESANLSA IQDELMEENS LSDLLLTGAD AVEAGDSSLA  120
LAVLSKLNSL LADTCENAAT SSFGRLAYHF AQGLQSRMSG TCSPCYPPAD PVQSGIMSAH  180
QMIQELSPYV KFAHFTANQA ILDATISDMD IHVVDFNLGD GIQWPSLMSD LARLGGKSFH  240
LTAIITDAGY SDDTHQAAAR RLSEFAESLN LPFQYSSLCI RHEEDLEDFS RNCGGSVVVS  300
CDTTNLCYRS GSKLQMLLLG CVRKLQPKSV VVIEEELVRI GKEACLSQAS FVEFFFEALH  360
HFTMVFESLS SCFSSNRACL RLVEKEMMGP KIQDFVGQYG SVTLEGAAGD PKALEGFKSC  420
ELSACNVAQA RMLVALFNRS FGTAHQKGRL QLCWKSIWLL LPKSQGGFIM EALISAAAGE  480
LVSRFISFMA QKFCDRTLNE GDHRRLEQLL LRIHTIVEEA EGRRITNRGM LLQLKMLMEG  540
MYQGHYMLDR FKIQHAEQGK IKGQGSHQSR SFAMSTLTAA KRLRFASATT KDTPVAFGTG  600
SLKGVLDSLE AKIQDMREFV MLLGSCPRLP RQMYCTYLFM DKCMFGRHTE KEHVINFLLC  660
SDGTHDDCPN LGILPIIGPH RVGKKTLVQH ACKDERVRGF FSKILFFKGD DLENAEFAVS  720
LEAASGKKCL FVVEFSWNVD EAAWANFKST FQEATGHGSK VLLIGRTQEV AKLGTAMPIW  780
MKSLSQEEYW YYFKALAFGS MDPDEHPKLA SLGMQLATEL KGSFLGANIL GEMLRSNPSA  840
QFWHAILSSV RALVQEHMFS LGVHPEDLLE RNVPVGFTNV SLVGAQSQGC LVYDLREADP  900
GQEELPLPTS REVLTGVKVP AEEKFDVLVW KSRIPPYISY VVTYERQKAP RRRVGKKSRL  960
ALREVSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-3312446035373Protein SCARECROW
5b3h_A2e-3312446034372Protein SCARECROW
5b3h_D2e-3312446034372Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.189780.0embryo| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G046250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715780.0EU971578.1 Zea mays clone 367514 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022684932.10.0uncharacterized protein LOC101766196
TrEMBLA0A1Z5RGS20.0A0A1Z5RGS2_SORBI; Uncharacterized protein
STRINGEMT194610.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.12e-39GRAS family protein