PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G019800.1.p
Common NameSb05g001690, SORBIDRAFT_05g001690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 99aa    MW: 10139 Da    PI: 7.0016
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G019800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.27.3e-322579358
           ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                           v+Y+eC++NhAas+GghavDGC+Efm+s g+egtaaa+ CaACgCHR+FHRreve
  Sobic.005G019800.1.p 25 VVHYRECQRNHAASIGGHAVDGCREFMAS-GAEGTAAAMACAACGCHRSFHRREVE 79
                          799*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.4E-302678IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-262778IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-102879IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.3992877IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MGPQQDRSSS MANGTAAARS KEAKVVHYRE CQRNHAASIG GHAVDGCREF MASGAEGTAA  60
AMACAACGCH RSFHRREVEA GGDDDRDCSS TSTSTTSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269791e-64KJ726979.1 Zea mays clone pUT3680 ZF-HD transcription factor (ZHD10) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448925.15e-65hypothetical protein SORBIDRAFT_05g001690
SwissprotQ2RB281e-34MIF1_ORYSJ; Mini zinc finger protein 1
SwissprotB8BIU81e-34MIF1_ORYSI; Mini zinc finger protein 1
TrEMBLC5Y3N85e-65C5Y3N8_SORBI; Putative uncharacterized protein Sb05g001690
STRINGSb05g001690.12e-64(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-14mini zinc finger 1