PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G017500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 712aa    MW: 75094 Da    PI: 6.5896
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G017500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.71e-1273437032374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsP 89 
                            +lLl+cAeav++++l  a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ lpp + +  + + +++aa+++f+ +sP
  Sobic.005G017500.2.p 343 LTLLLQCAEAVNADNLDDAHQTLLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPPGTPAAARlHGRVAAAFQVFNGISP 431
                           579************************************************************88777766658899999********* PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           ++kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s e+le+tg+rL++fA++lg+pfef
  Sobic.005G017500.2.p 432 FVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALEATGKRLSDFADTLGLPFEF 516
                           ************************************************************....************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            + va++  ++++e+L v ++Ea+aV++ +  h+l+d ++s ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysal
  Sobic.005G017500.2.p 517 CA-VAEKAGNVDPEKLGVTRREAVAVHWLH--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSAL 597
                           **.7*************************9..999999999999....**********************.899*************** PP

                  GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                           fdsl+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF++++l  +aa+qa+lll +++sdgy++ ee+g
  Sobic.005G017500.2.p 598 FDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRAASLAGSAAAQASLLLGMFPSDGYTLVEENG 685
                           *************************************999987.********************************************* PP

                  GRAS 357 slvlgWkdrpLvsvSaWr 374
                           +l lgWkd  L+++SaWr
  Sobic.005G017500.2.p 686 ALKLGWKDLCLLTASAWR 703
                           *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.832316683IPR005202Transcription factor GRAS
PfamPF035143.5E-125343703IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MGSSSLLLFP SSSSAASTAP HAFPHSHATA TASTSTSTSL LPPLPSPHHL PLPPPSSSSQ  60
SQDHFLLHYL HQLDRQEAAA AAAMVRKRPA QDMDLPPPRR HVTGDLSDVT AAAAGSGGAP  120
PSSASAQLPA LPTQLHQLPP AFQHHAAEVG VPVPAPPPPP PNPAAHAQAG GEAAASTTAW  180
VDGIIRDIIG SSGGAAVSIT QLIHNVREII HPCNPGLASL LELRLRSLLA ADPAPLPPPP  240
PQPSQQHALL HGVGAPAAAA GLTLPPPPPL QDKRRHEPPP PPPPPQQQQQ EEPHPASQSP  300
KAPTAEETAA AAAAAAAAAA AAAKERKEEQ RRKQRDEEGL HLLTLLLQCA EAVNADNLDD  360
AHQTLLEIAE LATPFGTSTQ RVAAYFAEAM SARLVSSCLG LYAPLPPGTP AAARLHGRVA  420
AAFQVFNGIS PFVKFSHFTA NQAIQEAFER EERVHIIDLD IMQGLQWPGL FHILASRPGG  480
PPRVRLTGLG ASMEALEATG KRLSDFADTL GLPFEFCAVA EKAGNVDPEK LGVTRREAVA  540
VHWLHHSLYD VTGSDSNTLW LIQRLAPKVV TMVEQDLSHS GSFLARFVEA IHYYSALFDS  600
LDASYGEDSP ERHVVEQQLL SREIRNVLAV GGPARTGDVK FGSWREKLAQ SGFRAASLAG  660
SAAAQASLLL GMFPSDGYTL VEENGALKLG WKDLCLLTAS AWRPIQMPPC R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A0.03267043380Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.78060.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in early stages of lateral root primordium formation, becoming restricted to the endodermal cell lineage at later stages. {ECO:0000269|PubMed:10948251}.
UniprotTISSUE SPECIFICITY: Expressed in the root endodermis and in a single file of cells through the quiescent center. {ECO:0000269|PubMed:10948251}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in establishing and maintaining the correct radial pattern in the root apical meristem. {ECO:0000269|PubMed:10948251}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G017500.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021317511.10.0protein SCARECROW
SwissprotQ9FUZ70.0SCR_MAIZE; Protein SCARECROW
TrEMBLA0A1Z5RG850.0A0A1Z5RG85_SORBI; Uncharacterized protein
STRINGGRMZM2G131516_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Representative plantOGRP21831437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Lim J, et al.
    Conservation and diversification of SCARECROW in maize.
    Plant Mol. Biol., 2005. 59(4): p. 619-30
    [PMID:16244911]