PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G004700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 214aa    MW: 23015.1 Da    PI: 6.9801
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G004700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.7e-45191181100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lqqq++q
  Sobic.005G004700.1.p  19 PCASCKLLRRRCTQECVFAPYFPPEDPHKFAIVHKVFGASNVSKMLQELPAQQRADAVSSLVYEANARMRDPVYGCVGAISYLQQQVSQ 107
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++lal+k+e
  Sobic.005G004700.1.p 108 LQVQLALAKAE 118
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.64418119IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4419116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MADSGNGSRS SSSSSSSPPC ASCKLLRRRC TQECVFAPYF PPEDPHKFAI VHKVFGASNV  60
SKMLQELPAQ QRADAVSSLV YEANARMRDP VYGCVGAISY LQQQVSQLQV QLALAKAEIL  120
CVQMHHDYES ASAAAAAAPA PAKQQQLQQQ QQEEMECEAY GNLLVQNGLM MNTLNGTGAV  180
HQQQKQMLGG FGSAGNTAMM LQEACLKKES LWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-48101202112LOB family transfactor Ramosa2.1
5ly0_B3e-48101202112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G004700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1008521e-121FP100852.1 Phyllostachys edulis cDNA clone: bphyst013p01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448864.21e-156LOB domain-containing protein 12
SwissprotQ8LBW37e-66LBD12_ARATH; LOB domain-containing protein 12
TrEMBLC5Y2Z91e-155C5Y2Z9_SORBI; Uncharacterized protein
STRINGSb05g000550.11e-103(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-57LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]