PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G001500.1.p
Common NameSb05g000310, SORBIDRAFT_05g000310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 341aa    MW: 36180.2 Da    PI: 9.1715
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G001500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.3e-3958116462
                zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +al+cprC+s+ntkfCyynnys+sqPryfCk+CrryWt+GGalrnvPvGgg+rknk++s
  Sobic.005G001500.1.p  58 EALRCPRCNSNNTKFCYYNNYSTSQPRYFCKGCRRYWTHGGALRNVPVGGGCRKNKRTS 116
                           7899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2754113IPR003851Zinc finger, Dof-type
PfamPF027019.9E-3359114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39460114IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106298IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MDMSSSSTAA ASSPQNHQQE AIVSSPIIKE EARSPKQAQV TQQASGSGER KPRPQLAEAL  60
RCPRCNSNNT KFCYYNNYST SQPRYFCKGC RRYWTHGGAL RNVPVGGGCR KNKRTSGSIS  120
ASGTSSSSSA AYAPLSPSTN TSSSKMSINT QLMMVPNMMM STSSMTGLFP NVLPTLMSAT  180
EGGEFNFTMD NQHASLPFTP MSLSNQASVP VLAAGESGTM PSFLEMLRKG LLHGSSSYDT  240
GLAMSDGNNG MDMSFPLPAY GAMHGHGLSG STTNDARQLV GTQQGVNTGG GFVGSTGVQE  300
EEEEGDNKAM VKSNKNNNGG SLLDRYWIKP NNNNNKRQQG *
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Seed endosperm. {ECO:0000269|PubMed:9207153}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.005G001500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5400850.0HQ540085.1 Sorghum bicolor clone SbDof19 Dof-type zinc finger protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448852.10.0dof zinc finger protein PBF
SwissprotO244631e-150PBF_MAIZE; Dof zinc finger protein PBF
TrEMBLC5Y2M80.0C5Y2M8_SORBI; Uncharacterized protein
STRINGSb05g000310.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-35Dof family protein
Publications ? help Back to Top
  1. Lang Z, et al.
    Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication.
    J. Hered., 2014 Jul-Aug. 105(4): p. 576-582
    [PMID:24683184]
  2. Zhang Z,Zheng X,Yang J,Messing J,Wu Y
    Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7
    [PMID:27621432]