PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G316500.3.p
Common NameSb04g034760, SORBIDRAFT_04g034760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 262aa    MW: 28517.9 Da    PI: 10.8531
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G316500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.68.7e-3392148158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh hA++R+RgsgGrF
  Sobic.004G316500.3.p  92 NEPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKARKPYLHESRHLHAMKRARGSGGRF 148
                           59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.8E-3890151IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.65791151IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-2893148IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.5E-2494116IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.5E-24125148IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MLSFLVSGNS FGNTVNDHMR STLSFDNKQS PFASQNIDYG QTIACISYPY NHSGSGGVWA  60
AYESGTTATT VFHSQISGGG ARIPLPLELA ENEPIYVNPK QYHGILRRRQ LRAKLEAQNK  120
LVKARKPYLH ESRHLHAMKR ARGSGGRFLN TKQFQQQQQS HTASTRSTTN GTSSSGSTHL  180
RLGGGAAGDR SMLAPKTMAS QDSSKKAVSS ALAFTVTPML HRDDAFLQHP SHYLSFSGHF  240
GQASVQAGMH NGSQHRVPFM R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2192153263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9619770.0EU961977.1 Zea mays clone 239433 nuclear transcription factor Y subunit A-3 mRNA, complete cds.
GenBankKM6557510.0KM655751.1 Zea mays NF-YA13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454647.10.0hypothetical protein SORBIDRAFT_04g034760
TrEMBLC5XTK10.0C5XTK1_SORBI; Putative uncharacterized protein Sb04g034760
STRINGSb04g034760.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.16e-37nuclear factor Y, subunit A5