PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G316500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 305aa    MW: 33129.1 Da    PI: 11.5619
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G316500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.1e-32135191158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh hA++R+RgsgGrF
  Sobic.004G316500.2.p 135 NEPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKARKPYLHESRHLHAMKRARGSGGRF 191
                           59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.8E-38133194IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.657134194IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-28136191IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-23137159IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-23168191IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MQPKGPDQRK GRQGGGKAQT QRTAFAWRTH RGRRVGAMLL PSSSSSPASK GNSFGNTVND  60
HMRSTLSFDN KQSPFASQNI DYGQTIACIS YPYNHSGSGG VWAAYESGTT ATTVFHSQIS  120
GGGARIPLPL ELAENEPIYV NPKQYHGILR RRQLRAKLEA QNKLVKARKP YLHESRHLHA  180
MKRARGSGGR FLNTKQFQQQ QQSHTASTRS TTNGTSSSGS THLRLGGGAA GDRSMLAPKT  240
MASQDSSKKA VSSALAFTVT PMLHRDDAFL QHPSHYLSFS GHFGQASVQA GMHNGSQHRV  300
PFMR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-21135196263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0174640.0BT017464.1 Zea mays clone EL01N0407G01.c mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454647.10.0hypothetical protein SORBIDRAFT_04g034760
TrEMBLC5XTK10.0C5XTK1_SORBI; Putative uncharacterized protein Sb04g034760
STRINGSb04g034760.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132762833
Representative plantOGRP1463244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-36nuclear factor Y, subunit A5