PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G284400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 458aa    MW: 45947 Da    PI: 9.3998
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G284400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.1e-39158219263
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                           kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Sobic.004G284400.1.p 158 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 219
                           7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-25157207IPR003851Zinc finger, Dof-type
PfamPF027013.3E-33160216IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.059162216IPR003851Zinc finger, Dof-type
PROSITE patternPS013610164200IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MKEKTREGAG SNSTTQAIHR TFLLPRPSHP VVPAVGGSSS SSSSSSSPVV VLSSSSSSPL  60
VGKRNTGESL ARSGIGILAC MDAAQWHQGL GLGKPMEEML MAGNANPNQN PNPPPPAPSA  120
PGAQRAGAPA AGAAAAPSAG ATGGPAGAGT ERRARPQKEK ALNCPRCNST NTKFCYYNNY  180
SLQQPRYFCK TCRRYWTEGG SLRNVPVGGG SRKNKRSSSA VSSAAAASTS AAMSGTVSVG  240
LPAKNPKLMH EGAHDLNLAF PHHNGRALQP PEFPAFPSLE SSSVCNPGAA GMVGNGAAGR  300
GMGALSAMEL LRSTGCYVPL QHVQLGMPAE YAAAGFALGE FRMPPPPQSH SVLGFSLDTH  360
GTGGVGGAGG YSAGLQDSAA GRLLFPFEDL KPAVSAAAGG GGASNGADHH QYEHSKDQAA  420
GDGGSGPSGV TGGHETPGFW SNSLIGNGSS NGGGGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202870.0callus
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G284400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824100.0KC582410.1 Sorghum bicolor dof16 protein (dof16) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021315849.10.0dof zinc finger protein DOF4.6 isoform X1
SwissprotB9F1L81e-131DOF2_ORYSJ; Dof zinc finger protein 2
TrEMBLA0A194YT630.0A0A194YT63_SORBI; Uncharacterized protein
STRINGSb04g032040.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.43e-32Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]