PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G266800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 407aa    MW: 43482.4 Da    PI: 7.0497
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G266800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer84.98.6e-27142194357
           ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                           ++rY+eCl+NhAa+lG+h++DGC+Efmps g++  aaal CaAC CHR+FHRre 
  Sobic.004G266800.1.p 142 QWRYRECLRNHAARLGAHVLDGCCEFMPS-GSD-GAAALACAACCCHRSFHRREA 194
                           789*************************9.555.589****************96 PP

2Homeobox16.71.2e-05295350152
                           TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                           +r Rt+ft+eq +++ e+ +    + ++p+a++     +++g++ r+ kvW +N +
  Sobic.004G266800.1.p 295 KRFRTKFTAEQKDRMREFAHrvgwRIHKPDADAVDAFCAQVGVSRRVLKVWMHNNK 350
                           789***********987655888779****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.2E-24143194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-10144193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-21144193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.115145193IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.9E-30285352IPR009057Homeodomain-like
SuperFamilySSF466892.55E-19287351IPR009057Homeodomain-like
TIGRFAMsTIGR015658.6E-27294350IPR006455Homeodomain, ZF-HD class
CDDcd000860.00693295348No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MEYKRSSHVE EEEEEDEEEE EEDEEEEEEE DEEARSHRYT TAAAAAAPVG APQQQQQQPP  60
LPPPGFLPAH RQPPHQLHPR KVERDRDRAA GAQQQPQVRR HQEPARNGVL GGGGGGGGGA  120
APPSAASTLG LVSVGPVVEA AQWRYRECLR NHAARLGAHV LDGCCEFMPS GSDGAAALAC  180
AACCCHRSFH RREAIPGGVA AAVAVSPSPV TPTAGAGANS SRVMPLLLAP PHMHTRPPHV  240
PASPASAPAA LTESSSEELR VPAPAHPAAP ATTHPPHAQV AVGGSASAPP APSKKRFRTK  300
FTAEQKDRMR EFAHRVGWRI HKPDADAVDA FCAQVGVSRR VLKVWMHNNK HLARIPPSPP  360
SSHQPPPLLP PHHHDHHPPP PPPPHHIHHH HPPPPPPPPP QQQHDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-222933621679ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567590.0EU956759.1 Zea mays clone 1572892 zinc finger homeodomain protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452677.11e-170hypothetical protein SORBIDRAFT_04g030480
SwissprotQ8S3Q92e-77ZHD7_ORYSJ; Zinc-finger homeodomain protein 7
TrEMBLC5Y0B01e-170C5Y0B0_SORBI; Putative uncharacterized protein Sb04g030480
STRINGSb04g030480.11e-170(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134912329
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-21homeobox protein 22