PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G266200.1.p
Common NameSb04g030420, SORBIDRAFT_04g030420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 296aa    MW: 30934.2 Da    PI: 8.2765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G266200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77.2e-4060120262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  Sobic.004G266200.1.p  60 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 120
                           7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2958113IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3361118IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22764118IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MMAGAPPMHI CMDSDWLKGI VPEEPGMGSS SPSAELIACP RPMHAVAAAA AADRRLRPQH  60
DQPLKCPRCE STHTKFCYYN NYSLSQPRYF CKTCRRYWTK GGSLRNVPVG GGCRKNKRAS  120
AKKPPAPPMQ PRHMAETGLH LSFSGMPQLP PPSADPLCSL GLLDWKYDPI LTGSGGGAAA  180
GSLDGASSEA HFAGAGMLGI PGGGGSGGEC HALSALRYAA GLGEHLQLQG LPFGGRAEHD  240
GMEVKPPATE RLLSLDWYSE TSRAPESAIS SLGALGLWSG MLGGAHQHHG SSAAI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202871e-42callus
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G266200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824110.0KC582411.1 Sorghum bicolor dof17 protein (dof17) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452673.10.0dof zinc finger protein DOF3.1
TrEMBLC5Y0A50.0C5Y0A5_SORBI; Uncharacterized protein
STRINGSb04g030420.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-38Dof family protein