PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G254000.1.p
Common Namedof18, Dof18, Sb04g029300, SORBIDRAFT_04g029300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 305aa    MW: 30986.4 Da    PI: 8.5731
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G254000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-3947106362
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            + +kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k++s
  Sobic.004G254000.1.p  47 PEVVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRAS 106
                           6789****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2936104IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3349104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.44150104IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105288IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAGA GDLRRAQAHA QQGPGARCGG VSPAAPPEVV KCPRCESTNT  60
KFCYYNNYNL SQPRHFCKSC RRYWTKGGVL RNVPVGGGCR KTKRASSSSS ATSSVPSTPT  120
SGSGDAAANK NPRRASASSP RSTNSGSASP TAAAATTPTP APTTPATPSS NSSVAVFTTS  180
SHHHSSPFST IDVVAPPAPI FADQAAALAS LFAPPPPPPL PVFTFAAQPK QEEAPTTTSE  240
LQLVAGLSAA APSSSSVVSE DMAPFASLDA AGIFELGDAA SAAAYWNAGS CWTDVVQDPS  300
MYLP*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in germinating seeds up to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G254000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824120.0KC582412.1 Sorghum bicolor dof18 protein (dof18) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452623.20.0mucin-7
SwissprotQ6Z3453e-89DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBLA0A194YSN90.0A0A194YSN9_SORBI; Uncharacterized protein
STRINGSb04g029300.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-33TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]