PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G185200.1.p
Common NameSb04g023410, SORBIDRAFT_04g023410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 324aa    MW: 35196.5 Da    PI: 6.3163
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G185200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41.1e-17153207256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++ eq   Le+ F+ ++++s +++ +LA++l+L  rqV vWFqNrRa+ k
  Sobic.004G185200.1.p 153 RKKLRLSMEQSAFLEDIFKAHSTLSPKQKSDLANRLSLRPRQVEVWFQNRRARTK 207
                           6788899**********************************************98 PP

2HD-ZIP_I/II122.91.5e-39153242190
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rls eq+++LE+ F+++++L+p++K++la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr+
  Sobic.004G185200.1.p 153 RKKLRLSMEQSAFLEDIFKAHSTLSPKQKSDLANRLSLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLAQENRRLQREVAELRA 241
                           69*************************************************************************************97 PP

           HD-ZIP_I/II  90 e 90 
                           +
  Sobic.004G185200.1.p 242 Q 242
                           6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.471149209IPR001356Homeobox domain
SuperFamilySSF466895.13E-17150218IPR009057Homeodomain-like
SMARTSM003899.4E-16151213IPR001356Homeobox domain
PfamPF000464.2E-15153207IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-16153207IPR009057Homeodomain-like
CDDcd000861.01E-15153210No hitNo description
PROSITE patternPS000270184207IPR017970Homeobox, conserved site
CDDcd146868.06E-4202243No hitNo description
PfamPF021834.6E-11209242IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-21209252IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MELELSLGDS RAPAKSTFMP ALTPIHAGEG EGHELVLELG VGTAKRAEQD NQKTVVQAEA  60
VQEEEEETCS YNESPVELSL VCPLLPASTE IGTVYSEVCG RGSDVNTVLV DGDTAQGRSL  120
STSSLALEVP VRQTADQEAA EDAEISGVGG GTRKKLRLSM EQSAFLEDIF KAHSTLSPKQ  180
KSDLANRLSL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCENLAQENR RLQREVAELR  240
AQRISNTAAY TFYGHHLPAS GFSTARVCPS CDKNKGTAHY TAISAPSAVV TPPSAVSTTL  300
FARPHFGPFT IHPLLRRQPS ATS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151157TRKKLRL
2201209RRARTKLKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G185200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314037.10.0homeobox-leucine zipper protein HOX7 isoform X1
SwissprotA2X6741e-105HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
SwissprotQ0E0A61e-105HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLA0A1Z5RNK70.0A0A1Z5RNK7_SORBI; Uncharacterized protein
STRINGSb04g023410.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-51homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]