PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G168800.1.p
Common NameSb04g022020, SORBIDRAFT_04g022020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 324aa    MW: 34942 Da    PI: 6.3615
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G168800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.65.4e-081892381463
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           R + +rsR RK+++i+eLe+ v++L++   +L+ ++++l ++ ++l +e+
  Sobic.004G168800.1.p 189 RRSGQRSRVRKLQYIAELERTVDSLQNMGADLAVRVSSLFQLHSALSMEN 238
                           67889**********************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147031.91E-16188231No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-5189248No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSMFTQSC RFPSGDPFFG EPPCWLDDLL ADSGKAPKLP  60
PLRRACSDSD AILDALSTFQ SPIYPIEEGD LNSGGEGEDL LDAGEGGESG SVVEACCVYG  120
PNSPRQKSRL TSSESSMVNA VLENVPSNPL QYLTIDASSG VNGNVASGTA DASDAFGFGH  180
PDQDKSFKRR SGQRSRVRKL QYIAELERTV DSLQNMGADL AVRVSSLFQL HSALSMENKQ  240
LRMQISSLQH AKLIKDGQTQ ALKNEAERLK QMSARHRRSR SVTSCYDPTS FGADASAVNW  300
QMPDMGRLSL NGSSVSPRGG YGL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188194RRSGQRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.129730.0pollen
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0684150.0BT068415.1 Zea mays full-length cDNA clone ZM_BFb0176P14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453946.10.0hypothetical protein SORBIDRAFT_04g022020
TrEMBLC5XU180.0C5XU18_SORBI; Putative uncharacterized protein Sb04g022020
STRINGSb04g022020.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP973745
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.24e-17bZIP family protein