PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G168100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family M-type_MADS
Protein Properties Length: 260aa    MW: 28239.5 Da    PI: 8.6427
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G168100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.77.2e-191050242
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                          ri n+s r  tf kRr+g++KKA+EL +LCd++ +v+++++
  Sobic.004G168100.1.p 10 RIANDSTRRGTFKKRRKGLMKKASELATLCDVDTCVVVYGE 50
                          89*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.642150IPR002100Transcription factor, MADS-box
CDDcd002662.44E-31285No hitNo description
SuperFamilySSF554553.4E-23394IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-12323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-181050IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MARKKVTLHR IANDSTRRGT FKKRRKGLMK KASELATLCD VDTCVVVYGE GESQAEVWPD  60
VPTAEHVLAR FKAVPELDQC KKMLDMEGFL KQRMDKLRDQ LHKAQRDNRE REATLLLHDA  120
IAGRRPGLVG LSVEEIASLG CMVESRLRGV KDAIERLQRM GQEVPAATVA QPQAPSSMPL  180
MPAYSAGTAG DRDMTMMQVP HQQAGWLVGG GDLGALVHGG FGAGTTSGAG GDMNMMMPQF  240
GNMAVGFAWS DPGQYFHSI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLHRIANDSTRRGTFKKRR
22125KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G168100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453942.20.0agamous-like MADS-box protein AGL80
TrEMBLC5XU070.0C5XU07_SORBI; Uncharacterized protein
STRINGSb04g021950.11e-124(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.14e-31AGAMOUS-like 80