PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G080300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 398aa    MW: 41775.3 Da    PI: 6.5089
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G080300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS300.25e-92303974374
                  GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                           l+l+ A  ++ gd   a+++  ++  +a p+gd+  Rla++f++ALa+r+a          +p ++     + +++a+ +++++ P+l+
  Sobic.004G080300.1.p  30 LVLATAGLIHRGDVDGARRAADQVLSTADPRGDAADRLAHHFARALARRVAA---------APAPAG---GAPTATAYLAYNQIAPFLR 106
                           6788999********************************************9.........444444...6778899999********* PP

                  GRAS  93 fshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                           f+hltaNqaIl+a+++   +r+Hi+D+d+ +G+QWp+Llqa+a+R+    gpp++RiTg g+    +++ l +tg+rL+ fA +l++pf
  Sobic.004G080300.1.p 107 FAHLTANQAILDAAASGgaRRLHIVDLDAAHGVQWPPLLQAIADRAdpaVGPPEVRITGAGP----DRDVLLRTGDRLRAFAGSLNLPF 191
                           ************9986555**************************977778***********....9********************** PP

                  GRAS 177 efnvl...vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse.........sF 253
                           +f++l    + +l++     L+++p+E+laVn+vl lhrl   ++++     ++Lk vks++P vv+++e+ea+ + +         ++
  Sobic.004G080300.1.p 192 RFHPLllpCTAQLAADPATGLELHPDETLAVNCVLFLHRLG-GEGEV----ATFLKWVKSMNPAVVTIAEKEASSSIGsdddcpppdDL 275
                           *****665555677778889********************8.44444....56*******************8874334589999999* PP

                  GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllr 342
                            +r++ a+ yysa+fd+lea++p+ s +r  vE+e+lgrei  ++a +  +  e    +e W ++ ++aG++p pls +a++qa+lllr
  Sobic.004G080300.1.p 276 PRRVAAAMGYYSAVFDALEATVPPGSADRLLVENEVLGREIDAALALAPGRVGEHSWGFEAWASAARAAGLSPRPLSAFAVSQARLLLR 364
                           ************************************************999899999******************************** PP

                  GRAS 343 kvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            ++ s+gy  ee +g+ +lgW++rpL+svS+W+
  Sobic.004G080300.1.p 365 LHYpSEGYVAEEARGACFLGWQTRPLMSVSSWQ 397
                           ********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.3531376IPR005202Transcription factor GRAS
PfamPF035141.7E-8930397IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MLGAPGHDGH HAAERAHEHA AAQPSSPRGL VLATAGLIHR GDVDGARRAA DQVLSTADPR  60
GDAADRLAHH FARALARRVA AAPAPAGGAP TATAYLAYNQ IAPFLRFAHL TANQAILDAA  120
ASGGARRLHI VDLDAAHGVQ WPPLLQAIAD RADPAVGPPE VRITGAGPDR DVLLRTGDRL  180
RAFAGSLNLP FRFHPLLLPC TAQLAADPAT GLELHPDETL AVNCVLFLHR LGGEGEVATF  240
LKWVKSMNPA VVTIAEKEAS SSIGSDDDCP PPDDLPRRVA AAMGYYSAVF DALEATVPPG  300
SADRLLVENE VLGREIDAAL ALAPGRVGEH SWGFEAWASA ARAAGLSPRP LSAFAVSQAR  360
LLLRLHYPSE GYVAEEARGA CFLGWQTRPL MSVSSWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-506139737375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a small number of epidermal or subepidermal cells at the leaf axils, in axillary meristems and the entire tiller buds. Undetected in the shoot apical meristem. {ECO:0000269|PubMed:12687001}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription regulator that controls rice tillering by initiating axillary buds and promoting their outgrowth. Rice tiller is a specialized grain-bearing branch that is formed on the unelongated basal internode and grows independently of the mother stem (culm) by means of its own adventitious roots. {ECO:0000269|PubMed:12687001}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G080300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9516670.0JQ951667.1 Chrysopogon gryllus Monoculm1B (moc1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021314637.10.0protein MONOCULM 1
SwissprotQ84MM91e-145MOC_ORYSJ; Protein MONOCULM 1
TrEMBLA0A194YNA50.0A0A194YNA5_SORBI; Uncharacterized protein
STRINGGRMZM2G143433_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36533479
Representative plantOGRP54911421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-73GRAS family protein
Publications ? help Back to Top
  1. Li X, et al.
    Control of tillering in rice.
    Nature, 2003. 422(6932): p. 618-21
    [PMID:12687001]
  2. Sun F, et al.
    Identification and functional analysis of the MOC1 interacting protein 1.
    J Genet Genomics, 2010. 37(1): p. 69-77
    [PMID:20171579]
  3. Sanyal A, et al.
    Orthologous comparisons of the Hd1 region across genera reveal Hd1 gene lability within diploid Oryza species and disruptions to microsynteny in Sorghum.
    Mol. Biol. Evol., 2010. 27(11): p. 2487-506
    [PMID:20522726]
  4. Yan WH, et al.
    A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice.
    Mol Plant, 2011. 4(2): p. 319-30
    [PMID:21148627]
  5. Xu C, et al.
    Degradation of MONOCULM 1 by APC/C(TAD1) regulates rice tillering.
    Nat Commun, 2012. 3: p. 750
    [PMID:22434193]
  6. Lin Q, et al.
    Rice APC/C(TE) controls tillering by mediating the degradation of MONOCULM 1.
    Nat Commun, 2012. 3: p. 752
    [PMID:22434195]
  7. Liang WH,Shang F,Lin QT,Lou C,Zhang J
    Tillering and panicle branching genes in rice.
    Gene, 2014. 537(1): p. 1-5
    [PMID:24345551]
  8. Zhang B, et al.
    Novel function of a putative MOC1 ortholog associated with spikelet number per spike in common wheat.
    Sci Rep, 2015. 5: p. 12211
    [PMID:26197925]