PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G003700.1.p
Common NameSb04g000520, SORBIDRAFT_04g000520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Trihelix
Protein Properties Length: 741aa    MW: 78466.6 Da    PI: 6.3185
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G003700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.21.6e-31555639186
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                           rW+k+ev aLi++r+ +e r+++  lk+plWeevs++m++ g+ rs+k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  Sobic.004G003700.1.p 555 RWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSARMAAAGYGRSAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 639
                           8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.317548612IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.3E-4551611IPR009057Homeodomain-like
SMARTSM007170.0065552614IPR001005SANT/Myb domain
CDDcd122039.56E-30554619No hitNo description
PfamPF138378.0E-23554641No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 741 aa     Download sequence    Send to blast
MQSGYGGVSE FQQFIMDGGF AMSAPPPQQQ PPQPAAASAQ ELGGPFRYQP LHHHALPPQH  60
HHHAPHMPPH FAHFGAAPPP PFTQQLLHQA AAAGHHHLQL FHEQQQQHHH HHKPQPPPPH  120
PQHHQLPARW APQPQQQQHH HQQQQPQAQT HHHHHHHLGF DVEAAVPESS GAAGAAASGG  180
AAPPGVPPFL AAAMNFKLAV DAGGGSGATG GTDDALNDGG GAAGSGMMLH VGGGGGGDDE  240
AATESRLRRW AGDEETSIKE PTWRPLDIDY LHSSSSSKRT GKEKVATPES PAPVAAANYF  300
KKGDDNAAAA AAAAAAGGGN YKLFSELEAI YKPGSGGAGV AQTGSGSGLT GDDNAILEPA  360
MADLPDVAAA AAGPQLNTSE TSAGEEAAAV VQPQPQLQPS TDAARRKRKR RRQQQQEQLS  420
ASASFFERLV QRLMEHQESL HRQFLEAMER RERERAARDE AWRRQEADKF AREAGARAQD  480
RASAAAREAA IIAYLEKISG ESITLPPPAA ASGDDTSQDA TAAGNGKELV PYDGGDATAH  540
DGGGAGGSLH LSTSRWPKHE VEALIRVRTG LEGRFQEPGL KGPLWEEVSA RMAAAGYGRS  600
AKRCKEKWEN INKYFRKAKE SGKKRPAHAK TCPYFDELDR LYSRSGHSAA AARDGEANAG  660
GGEAKQASSE LLDAVVKYPD VRYGPPGFGM DREQVSGGNN NANNEGGEDD GDGEEDGIGK  720
GRAGDDQDDD EVDSHGHDDE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1404409RRKRKR
2405410RKRKRR
3405411RKRKRRR
4406411KRKRRR
5407411RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.004G003700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453128.10.0trihelix transcription factor GTL1
TrEMBLC5XRJ00.0C5XRJ0_SORBI; Uncharacterized protein
STRINGSb04g000520.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63993547
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.25e-37Trihelix family protein