PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G392800.1.p
Common NameSb03g043030, SORBIDRAFT_03g043030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 538aa    MW: 57349.9 Da    PI: 6.1618
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G392800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.51.4e-1041635361374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel....ykalppsetseknsseelaalklfs 85 
                           lv+lL++cAeav+ +d ++a alL +l+  a  +g+++qR+a++f+++La rla   +      + a+   ++ + +   +  al l +
  Sobic.003G392800.1.p 163 LVQLLVACAEAVACRDRAQAAALLRELQAGAPVHGTAFQRVASCFVQGLADRLALAHPPAlgpaSMAFCIPPSCTGRDGARGEALALAY 251
                           689**************************************************9865544111122333333333346777788899** PP

                  GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGl....QWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfA 169
                           e++P+l+f+h++aN  Ilea+ege+ vH++D++++ Gl    QW  Ll+ La+R++ +p ++R+T+vg+     +e+++++g+ L+ +A
  Sobic.003G392800.1.p 252 ELCPYLRFAHFVANASILEAFEGESNVHVLDLGMTLGLdrahQWRGLLDGLAARAGAKPaRVRVTAVGA----PAETMRAVGRELEAYA 336
                           *********************************999866666*************66555*********....89************** PP

                  GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                           e lg+ +ef++ + ++le+l++++L +  +Ea+a++++l+lh +++es    +   +vL+++++lsPk +v+veq+a hn++ Fl rf+
  Sobic.003G392800.1.p 337 EGLGLCLEFRA-IDRSLESLHMDDLGIAADEAVAISSILELHCVVKESRGALN---SVLQTIRKLSPKAFVLVEQDAGHNGPFFLGRFM 421
                           ***********.699******************************88877777...8******************************** PP

                  GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.s 346
                           eal+yy+a+fd+l+a lpr +  r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF++vp++    + a+  l++ + +
  Sobic.003G392800.1.p 422 EALHYYAAVFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSVPIRMA--ARAREWLEENAgG 508
                           ***********************************************************************865..5678888888879 PP

                  GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaWr 374
                            gy+v ee+g+lvlgWk++p++++S+W+
  Sobic.003G392800.1.p 509 GGYTVAEEKGCLVLGWKGKPVIAASCWK 536
                           99*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.484137517IPR005202Transcription factor GRAS
PfamPF035145.0E-102163536IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MGTSEQPCTS NLFTASSYGT SQQIHHLLPQ HDSVICTEPG MGFPYYYGTD QQDAAFDGDE  60
VELGFQASKA TRVDYYSSPY QPSWPLARAA ATESSRVRKQ RFRDVLESCK QKVEAMEAME  120
SPVAFQEGED GLAVGDGGGA GAAAGGGAGA GGGNGGGADG MRLVQLLVAC AEAVACRDRA  180
QAAALLRELQ AGAPVHGTAF QRVASCFVQG LADRLALAHP PALGPASMAF CIPPSCTGRD  240
GARGEALALA YELCPYLRFA HFVANASILE AFEGESNVHV LDLGMTLGLD RAHQWRGLLD  300
GLAARAGAKP ARVRVTAVGA PAETMRAVGR ELEAYAEGLG LCLEFRAIDR SLESLHMDDL  360
GIAADEAVAI SSILELHCVV KESRGALNSV LQTIRKLSPK AFVLVEQDAG HNGPFFLGRF  420
MEALHYYAAV FDALDAALPR YDARRARVEQ FHFGAEIRNV VGCEGAARVE RHERADQWRR  480
RMSRAGFQSV PIRMAARARE WLEENAGGGG YTVAEEKGCL VLGWKGKPVI AASCWKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-5517053526378Protein SCARECROW
5b3h_A3e-5517053525377Protein SCARECROW
5b3h_D3e-5517053525377Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G392800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037910.0AP003791.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1065G12.
GenBankAP0067570.0AP006757.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0551C06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456800.10.0DELLA protein RGL1
TrEMBLC5XFG60.0C5XFG6_SORBI; Uncharacterized protein
STRINGSb03g043030.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Representative plantOGRP70521119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.12e-63GRAS family protein