PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G386900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 322aa    MW: 35065.3 Da    PI: 6.5085
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G386900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS49.57.6e-164114513117
                  GRAS  13 ssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkfshltaN 99 
                           +s+d +laq++++ l+++as++gdp qRl++ +++AL ar  r +  +  ++++ + ++   ++++++++l  + +++ +++f++ + N
  Sobic.003G386900.1.p  41 RSNDVTLAQQAMWVLNNIASSQGDPSQRLTSWLLRALVARACRLCGPTG-TIQAAAGAPAPRERAMSVTELaeYIDLTQWHRFCFTASN 128
                           57999***********************************999544333.233333332334444444444559*************** PP

                  GRAS 100 qaIleavegeervHiiDf 117
                           ++Il+av+g+ +vHiiD+
  Sobic.003G386900.1.p 129 STILRAVAGS-AVHIIDL 145
                           ********96.7*****8 PP

2GRAS92.75.9e-29157296224365
                  GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetl 312
                           rd++L++v++l+P +v+v+ ++ad++s+s+++r++ ++++++ lfd+l++ +pr+s +r+  E++ +gr+i++vv    a+  er e+ 
  Sobic.003G386900.1.p 157 RDTFLDIVRTLNPCLVTVTGEDADLDSPSLATRIAGCFDFHWILFDALDTAAPRDSPWRVEHEAA-VGRKIESVVGDDDADGAERVESG 244
                           89**************************************************************9.*********************** PP

                  GRAS 313 ekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                           ++  e++++ GF +v l+e+aa+++++ll++++  g+ v+ e++ lvl+Wk++
  Sobic.003G386900.1.p 245 ARLAEQMRRNGFASVGLDEDAAAEVRRLLSEHA-TGWGVKREEDMLVLTWKGH 296
                           *********************************.99**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.9911286IPR005202Transcription factor GRAS
PfamPF035142.6E-1341145IPR005202Transcription factor GRAS
PfamPF035142.0E-26157296IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MEQELRTDGG GNLRAAHNSV CFSGTLIDGP LAAPPLRRGA RSNDVTLAQQ AMWVLNNIAS  60
SQGDPSQRLT SWLLRALVAR ACRLCGPTGT IQAAAGAPAP RERAMSVTEL AEYIDLTQWH  120
RFCFTASNST ILRAVAGSAV HIIDLRSWIR HVAPGFRDTF LDIVRTLNPC LVTVTGEDAD  180
LDSPSLATRI AGCFDFHWIL FDALDTAAPR DSPWRVEHEA AVGRKIESVV GDDDADGAER  240
VESGARLAEQ MRRNGFASVG LDEDAAAEVR RLLSEHATGW GVKREEDMLV LTWKGHDASV  300
ENRRHAGRHV PNTTHQNSHR V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270021e-165KJ727002.1 Zea mays clone pUT3978 GRAS transcription factor (GRAS62) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456775.10.0hypothetical protein SORBIDRAFT_03g042530
TrEMBLC5XET40.0C5XET4_SORBI; Putative uncharacterized protein Sb03g042530
STRINGSb03g042530.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122273238
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.13e-33GRAS family protein