PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G383700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family LBD
Protein Properties Length: 333aa    MW: 34635.3 Da    PI: 9.0403
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G383700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.3e-43106204199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+q
  Sobic.003G383700.2.p 106 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQ 194
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           l+++la++k 
  Sobic.003G383700.2.p 195 LQQDLARAKY 204
                           *****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.729105206IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-43106202IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVLHKAPVSK GLFFFLCPPR LRALSLRASQ LGDDYAKCPG LLQARSLLLY TSFPGLLRSS  60
DSSSPATSTA SRRMASSVPA PSGSVITVAS SSSSAAAAAV CGTGSPCAAC KFLRRKCQPD  120
CVFAPYFPPD NPQKFVHVHR VFGASNVTKL LNELHPFQRE DAVNSLAYEA DMRLRDPVYG  180
CVGVISILQH NLRQLQQDLA RAKYELSKYQ AAAAASASTA APNGPQAMAE FIGNAMPNGA  240
HNFINIGHSA ALGSLGGSAT VFGQEQFANA QMLSRSYDGE PIARLGINGG YEFGYSTAMG  300
GSGAVSGLGT LGISPFLKSG TAGGDEKPSG GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-53962221127LOB family transfactor Ramosa2.1
5ly0_B6e-53962221127LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.54720.0pollen
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In embryo sac, detected as early as the one-nucleus stage. In older embryo sacs, highest expression in antipodal cells. {ECO:0000269|PubMed:17209126}.
UniprotTISSUE SPECIFICITY: Expressed in leaves, leaf primordia, immature ears, immature tassels, whole ovules, silk and husk leaves. Found on the adaxial side of organs. {ECO:0000269|PubMed:17209126}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G383700.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9406810.0AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021311343.10.0LOB domain-containing protein 6 isoform X2
SwissprotQ32SG31e-166LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A1W0W0W90.0A0A1W0W0W9_SORBI; Uncharacterized protein
STRINGSb03g042310.20.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-57LBD family protein