PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G382300.1.p
Common NameSb03g042210, SORBIDRAFT_03g042210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NAC
Protein Properties Length: 443aa    MW: 47230.4 Da    PI: 8.9703
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G382300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49431692128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                           +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+
  Sobic.003G382300.1.p  43 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADR 130
                           79***************************.89***************888889************************************ PP

                   NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++++  +++ +glkktLvfy+g+apkg++++W+m+eyrl
  Sobic.003G382300.1.p 131 TIKADnSSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 169
                           **99856778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-5542189IPR003441NAC domain
PROSITE profilePS5100555.94842190IPR003441NAC domain
PfamPF023651.1E-2444169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MSGGGGSRNE NGHGGAAAAA AAAAVVAAGG GGGGDAHEDD LVMPGFRFHP TEEELIEFYL  60
RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWFF YVPRDRKYRN GDRPNRVTAS  120
GYWKATGADR TIKADNSSRP IGLKKTLVFY SGKAPKGVRS SWIMNEYRLP QDHTDRYHKT  180
EISLCRVYKR TGIDDGHGHH PATARSTTPS RGATAAQQQD NKQASSSSTP TPPTTPSKMM  240
HLLHGECTSP PTAICRNNNH AAAAHSDNKT AAEPRQQQLP IKPYCNGYHH QLSTASSTTA  300
AAARDQQQAA MGTAAVSSSS SYEQSSRNAN YAFAASTYSL LSLVNAASMG GSGSAAAIDE  360
LSTLVGHVHG QPTYFNHQPG GGGHGHSFLP GLTTPSSQQP PMAALGTLPM SLAAISDKMI  420
WDWNPIVPDA AARDFSTGGG FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-524419019165NO APICAL MERISTEM PROTEIN
1ut4_B3e-524419019165NO APICAL MERISTEM PROTEIN
1ut7_A3e-524419019165NO APICAL MERISTEM PROTEIN
1ut7_B3e-524419019165NO APICAL MERISTEM PROTEIN
4dul_A3e-524419019165NAC domain-containing protein 19
4dul_B3e-524419019165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9571310.0EU957131.1 Zea mays clone 1583712 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456762.10.0hypothetical protein SORBIDRAFT_03g042210
TrEMBLC5XEP70.0C5XEP7_SORBI; Putative uncharacterized protein Sb03g042210
STRINGSb03g042210.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.24e-99NAC domain containing protein 35