PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G377900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 570aa    MW: 63270.1 Da    PI: 4.7671
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G377900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.55.7e-1282005692374
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cA+a+s+ ++ +aqa++++l++++s +gdp qR+aay++e+Laar++ s++++ykal++++ +   +  +l+a+++++e++P+
  Sobic.003G377900.1.p 200 KQLLFDCATALSEYNTDEAQAIITELRQMVSIQGDPSQRIAAYLVEGLAARIVASGNGIYKALTCKDPP---TLYQLSAMQILFEICPC 285
                           589*****************************************************************9...89999************ PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           +++++++aN aI+ea +geer+HiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+k+Ae +gv+fe
  Sobic.003G377900.1.p 286 FRLGFMAANYAIVEACKGEERLHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrPIGGLRVIGQRLEKLAEDCGVSFE 374
                           *************************************************************99878899******************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f++ v  ++ d+++ +L+++pgEal+Vn+++qlh+l+desvs+ +erd++L++vk+l Pk+v++veq+a++n+++Fl rf e  +yysa
  Sobic.003G377900.1.p 375 FRA-VGANIGDVTPAMLDCRPGEALVVNFAFQLHHLPDESVSIMNERDQLLRMVKGLHPKLVTLVEQDANTNTAPFLPRFREVYDYYSA 462
                           ***.799********************************************************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           lfdsl+a+lpres +r++vEr++l+reivn++aceg +r+er e ++kWr+r+++aGF p ++++++ + +k+ l+ + ++ y+ +e++
  Sobic.003G377900.1.p 463 LFDSLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVERYEVAGKWRARMTMAGFIPCAFNSNVISGIKSTLKSYCDR-YKFHEDH 550
                           *******************************************************************************66.******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaWr 374
                           g l +gW +++L++ SaW+
  Sobic.003G377900.1.p 551 GGLHFGWGEKTLIVSSAWQ 569
                           ******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.566173550IPR005202Transcription factor GRAS
PfamPF035142.0E-125200569IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MSFARRLDPS AYTDNLYIHK FATPSSTFAA RRFSSDTQLF RYDPEPYNEY GHMGFTGAPS  60
AAFQNSLCSQ QASLKPYHVT NDGRSPSVAD TQSNSCSDAA KDSPVVSNVS QQNSQSVSDS  120
QSSEIEVEFD EDDIRLKLQE LEHALLDDGD DILFDISQAG SINDEWADPM KNVLLPNSPK  180
ESESSISCAV SNSGAPRTPK QLLFDCATAL SEYNTDEAQA IITELRQMVS IQGDPSQRIA  240
AYLVEGLAAR IVASGNGIYK ALTCKDPPTL YQLSAMQILF EICPCFRLGF MAANYAIVEA  300
CKGEERLHII DFDINQGSQY ITLIQFLKNN ANKPRHLRIT GVDDPETVQR PIGGLRVIGQ  360
RLEKLAEDCG VSFEFRAVGA NIGDVTPAML DCRPGEALVV NFAFQLHHLP DESVSIMNER  420
DQLLRMVKGL HPKLVTLVEQ DANTNTAPFL PRFREVYDYY SALFDSLDAT LPRESPDRMN  480
VERQCLAREI VNILACEGPD RVERYEVAGK WRARMTMAGF IPCAFNSNVI SGIKSTLKSY  540
CDRYKFHEDH GGLHFGWGEK TLIVSSAWQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-6220656826378Protein SCARECROW
5b3h_A6e-6220656825377Protein SCARECROW
5b3h_D6e-6220656825377Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.64000.0embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G377900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021312901.10.0scarecrow-like protein 1
RefseqXP_021312902.10.0scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A1B6Q7E50.0A0A1B6Q7E5_SORBI; Uncharacterized protein
STRINGSb03g041760.20.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Representative plantOGRP82621116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]