PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G368300.1.p
Common NameSb03g040970, SORBIDRAFT_03g040970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 263aa    MW: 27793.4 Da    PI: 9.8947
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G368300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14180229352
                           XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                           + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN +L  e ee 
  Sobic.003G368300.1.p 180 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLREQEER 229
                           689*************************************9987766543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.5E-8178240IPR004827Basic-leucine zipper domain
PfamPF001701.0E-13180237IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76180228IPR004827Basic-leucine zipper domain
CDDcd147075.64E-19182232No hitNo description
SuperFamilySSF579595.5E-11183230No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-13183238No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MASSRVMPSS SPSHTASDLA RLAQAASRPG GGGGGSGLGS MNVEELLRGI YGEMPTPAPP  60
ASEPERPMSP APAPEIATRK TAEQVWKEIT GGGATGEAVA PVAAQAAVPA GAGGATGGPE  120
MTLEDFLARE GAVKDDEVRI SGPSAPVMGF LGGTEGVGVP GGGGGRGRKR QLMDPVDRAA  180
MQRQKRMIKN RESAARSRER KQAYIAELES LVTQLEEENA ELLREQEERH QKRLKELLER  240
VTPVILRKKP SRDLRRTNSM QW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.33180.0callus| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G368300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0541490.0BT054149.1 Zea mays full-length cDNA clone ZM_BFb0134E03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458823.10.0G-box-binding factor 4
SwissprotQ0JHF19e-97BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLC5XQN20.0C5XQN2_SORBI; Uncharacterized protein
STRINGSb03g040970.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Representative plantOGRP9845410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.12e-19G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]