PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G367100.1.p
Common NameDof11, Sb03g040860, SORBIDRAFT_03g040860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 336aa    MW: 35258.1 Da    PI: 4.5438
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G367100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18.3e-383389561
                zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          a +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  Sobic.003G367100.1.p 33 APNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 89
                          568***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-361788IPR003851Zinc finger, Dof-type
PfamPF027017.3E-323388IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MLSSHHEAML PYAPGPPPSL LVDRRYKQGG EAAPNCPRCD SPNTKFCYYN NYSLSQPRYF  60
CKGCRRYWTK GGSLRNVPVG GGCRKNRRGK SSLRSAADAA IASGGGRDAA FGHHRFPGPV  120
RPDLVLEGMV GNPSNPAGQA MPGGVPAATD GSTIDLAMLY AKFLNHPPAE EGVNAVTPES  180
AGQVVDEAFD TFSASSDLSP GVLAPLQFDP CHDGFGEWSA GGPVSSTGPS STASTTAATT  240
MLCADVSVQA AFGELNFAMD QSCFDSLGLP TDDVVGNLSS SWCSIVPGLS TLEDTKYDSL  300
DSFPDDALSL HEDMISGTDH DWSVDCQGLE ALYMP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G367100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824080.0KC582408.1 Sorghum bicolor dof11 protein (dof11) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458818.10.0dof zinc finger protein DOF5.1
TrEMBLC5XQM20.0C5XQM2_SORBI; Dof-type zinc finger protein 11
STRINGSb03g040860.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.12e-36Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]