PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G301700.1.p
Common NameDof12, Sb03g035080, SORBIDRAFT_03g035080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 261aa    MW: 27855.2 Da    PI: 9.1352
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G301700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.52.5e-37143197559
                zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                            l+cprC s+ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+
  Sobic.003G301700.1.p 143 PLPCPRCRSRNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNR 197
                           679**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.733144198IPR003851Zinc finger, Dof-type
PfamPF027011.3E-30144197IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-19153197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MLSHVEMAPA AGGFKLFGKV ITRTQCAAET APPAVPTQEQ EPAAAASRST AAFARERDDP  60
DERDQPMVKR EAAAAAASDH DFVVVADKQQ QQHSAAAGGP APASESDDSK GQQQHPRPRQ  120
HHQQQHQDTV EARAAAAASS APPLPCPRCR SRNTKFCYFN NYNVNQPRHF CKDCHRYWTA  180
GGALRNVPVG AGRRKNRPLG PVGAVPVPVP VPVPVPAHLH PAAAAGFVLG FPGQHPSSPT  240
TSPSTAVYAE RWPVCPDRRF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G301700.1.p
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824090.0KC582409.1 Sorghum bicolor dof12 protein (dof12) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458519.20.0uncharacterized protein LOC8075606
TrEMBLA0A1B6Q6620.0A0A1B6Q662_SORBI; Uncharacterized protein
STRINGSb03g035080.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.14e-26Dof family protein
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]