PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G276000.1.p
Common NameSb03g032800, SORBIDRAFT_03g032800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 226aa    MW: 23958.8 Da    PI: 8.5814
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G276000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.57.5e-30140198159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++d+++v+++Yeg Hnh 
  Sobic.003G276000.1.p 140 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDKDDQRYVVTMYEGVHNHV 198
                           59********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-30127199IPR003657WRKY domain
PROSITE profilePS5081130.308135200IPR003657WRKY domain
SuperFamilySSF1182903.79E-26136199IPR003657WRKY domain
SMARTSM007741.1E-32140199IPR003657WRKY domain
PfamPF031061.9E-23141197IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MHMALSSRSS FAAADVLLPA AMAYRQPCSG GGGGPATSSY FGSRPAAPFF PFGTAAQLDV  60
FECLSDEGGA VPAPPAAVPG AFATPPPPLP LMPAERVVPD AAAGYSSHAR SAAAAAAGEG  120
PPRRTDRIAF RVRSDDEEVL DDGYKWRKYG KKSVKNSPNP RNYYRCSTEG CSVKKRVERD  180
KDDQRYVVTM YEGVHNHVSP GTIYYATQDA ASGRFFVAGM HQPGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-211382001274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1968500.0AC196850.2 Sorghum bicolor clone SB_BBc0140O05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458400.11e-162hypothetical protein SORBIDRAFT_03g032800
TrEMBLC5XIA01e-162C5XIA0_SORBI; Putative uncharacterized protein Sb03g032800
STRINGSb03g032800.11e-162(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-35WRKY DNA-binding protein 51