PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G237201.1.p
Common NameSb03g029470, SORBIDRAFT_03g029470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 296aa    MW: 31529.2 Da    PI: 4.9439
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G237201.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS291.62.1e-891259120374
                  GRAS 120 sqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvl 208
                           +qGlQWpaL+qaLa Rp+gppslR+Tg+g+p++  ++ l+ +g rLa++A++++v+f+f+ ++a+rl+++++++L+v +gEa+aVn+vl
  Sobic.003G237201.1.p   1 MQGLQWPALIQALALRPGGPPSLRLTGIGPPSPPGRDDLRDVGVRLADLARSVRVHFSFRGVAANRLDEVRPWMLQVAQGEAVAVNSVL 89 
                           69*************************************************************************************** PP

                  GRAS 209 qlhrlldesvsles.......erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                           qlhrll++++s +        ++d+vL++v s++Pkv++vveqeadhn++ Fl+rf+eal yysa+fdsl+a       +     +++l
  Sobic.003G237201.1.p  90 QLHRLLADDASFSAddarpraPIDAVLDCVASVRPKVLTVVEQEADHNKPGFLDRFTEALFYYSAVFDSLDAA---SGGAGDAAAEAYL 175
                           ******88777665556666689***********************************************998...235555666777* PP

                  GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           +rei+++v+ ega+rrerhe l +Wr+rl++aG+ +vpl+ +a  qa++l+  ++++g+ vee +g+l+lgW++rpL+s+SaWr
  Sobic.003G237201.1.p 176 EREICDIVCGEGADRRERHEPLWRWRDRLGRAGLAAVPLGANALRQARMLVGLFSGEGHCVEEAEGCLTLGWHGRPLFSASAWR 259
                           ***********************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035147.0E-871259IPR005202Transcription factor GRAS
PROSITE profilePS5098542.0671239IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MQGLQWPALI QALALRPGGP PSLRLTGIGP PSPPGRDDLR DVGVRLADLA RSVRVHFSFR  60
GVAANRLDEV RPWMLQVAQG EAVAVNSVLQ LHRLLADDAS FSADDARPRA PIDAVLDCVA  120
SVRPKVLTVV EQEADHNKPG FLDRFTEALF YYSAVFDSLD AASGGAGDAA AEAYLEREIC  180
DIVCGEGADR RERHEPLWRW RDRLGRAGLA AVPLGANALR QARMLVGLFS GEGHCVEEAE  240
GCLTLGWHGR PLFSASAWRA AEENNQSDSC NADGSRSSGS GSGSGSEESN ISCSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-321259119375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698160.0EU969816.1 Zea mays clone 336035 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458232.10.0hypothetical protein SORBIDRAFT_03g029470
SwissprotQ9LQT87e-94GAI_ARATH; DELLA protein GAI
TrEMBLC5XF600.0C5XF60_SORBI; Putative uncharacterized protein Sb03g029470
STRINGSb03g029470.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.15e-83GRAS family protein