PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G235900.1.p
Common NameSb03g029330, SORBIDRAFT_03g029330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25256.3 Da    PI: 9.4668
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G235900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1979134156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           r+k+ +++keq + Lee F+ n++p+ +++e LA kl+L  rqV vWFqNrRa+ k
  Sobic.003G235900.1.p  79 RSKKLRLSKEQSRLLEESFRFNHTPTPKQKEALAGKLQLRPRQVEVWFQNRRARTK 134
                           5678899***********************************************98 PP

2HD-ZIP_I/II115.63e-3781168289
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           kk+rlskeq++lLEesF+ +++ +p++K++la +L+l+prqv+vWFqnrRARtk+kq+E ++e+Lkr++ +l+een+rL++eveeLr+
  Sobic.003G235900.1.p  81 KKLRLSKEQSRLLEESFRFNHTPTPKQKEALAGKLQLRPRQVEVWFQNRRARTKLKQTELECEYLKRCFGSLTEENRRLQREVEELRA 168
                           9*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1962134IPR009057Homeodomain-like
SuperFamilySSF466895.99E-2067137IPR009057Homeodomain-like
PROSITE profilePS5007117.70276136IPR001356Homeobox domain
SMARTSM003895.2E-1678140IPR001356Homeobox domain
CDDcd000861.81E-1579137No hitNo description
PfamPF000461.4E-1679134IPR001356Homeobox domain
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PfamPF021831.1E-9136169IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-22136179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGSTSPSGLE LTMAVPGLSS SSGSEGFGCN NNGNGNGNNM RDLDMNQPAS GGEEEEFPMG  60
SVEEEEDERG GAGGRGPHRS KKLRLSKEQS RLLEESFRFN HTPTPKQKEA LAGKLQLRPR  120
QVEVWFQNRR ARTKLKQTEL ECEYLKRCFG SLTEENRRLQ REVEELRAMR VAPPTVLSPH  180
SRQPLPASAL TMCPRCERIT AATAARTPRP AAAAAAGSNP FHPRRPSAAF *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.40241e-45callus| embryo
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G235900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0626880.0BT062688.2 Zea mays full-length cDNA clone ZM_BFb0333H18 mRNA, complete cds.
GenBankEU9661900.0EU966190.1 Zea mays clone 292384 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458223.11e-166homeobox-leucine zipper protein HOX3
SwissprotQ0JKX11e-120HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH381e-120HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLC5XF451e-165C5XF45_SORBI; Uncharacterized protein
STRINGSb03g029330.11e-166(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP68263549
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.12e-56homeobox-leucine zipper protein 17