PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G199400.1.p
Common NameSb03g026170, SORBIDRAFT_03g026170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family WRKY
Protein Properties Length: 217aa    MW: 23757 Da    PI: 5.8053
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G199400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.44.7e-31137195159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYG+K vk+s++pr+YYrC+s+gC+vkk+ver+++d ++v++tY g Hnh+
  Sobic.003G199400.1.p 137 LDDGYRWRKYGKKLVKNSPNPRNYYRCSSEGCRVKKRVERERDDARFVITTYDGVHNHP 195
                           59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-33125195IPR003657WRKY domain
SuperFamilySSF1182901.1E-27130196IPR003657WRKY domain
PROSITE profilePS5081132.064132197IPR003657WRKY domain
SMARTSM007746.2E-36137196IPR003657WRKY domain
PfamPF031061.3E-24138195IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MSSSYSSLLS PSRAHADDHR VLLGGDADDD DMAAVSSYLS LDDIVDDVVG GEWYRPLAEE  60
SSSAAAAELQ PEPLLFATLQ AEDGYCVSGS GGEQSSAALA NDNHDRIDLT QDGGSRRLLR  120
SEHGKIAFKT RSDVDVLDDG YRWRKYGKKL VKNSPNPRNY YRCSSEGCRV KKRVERERDD  180
ARFVITTYDG VHNHPAAAPP RSPAYRLGEP PHGHHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-25124194474Probable WRKY transcription factor 4
1wj2_A2e-25124194474Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.190802e-53shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8313671e-84CT831367.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI006O16, full insert sequence.
GenBankAY3418461e-84AY341846.1 Oryza sativa (japonica cultivar-group) WRKY5 mRNA, complete cds.
GenBankAK1085221e-84AK108522.1 Oryza sativa Japonica Group cDNA clone:002-144-B05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455850.11e-158hypothetical protein SORBIDRAFT_03g026170
TrEMBLC5XPE61e-158C5XPE6_SORBI; Putative uncharacterized protein Sb03g026170
STRINGSb03g026170.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-38WRKY DNA-binding protein 50