PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G137500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family M-type_MADS
Protein Properties Length: 243aa    MW: 27719.9 Da    PI: 10.2849
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G137500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.99.4e-121152344
                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                          i   s+r  tf +Rr  i KK  EL +LC+++v v+++s+++
  Sobic.003G137500.1.p 11 ITKASKRRATFRRRRDSIKKKVDELATLCGTKVGVVLYSEDQ 52
                          667899*********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.558150IPR002100Transcription factor, MADS-box
SMARTSM004329.7E-11160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-18390IPR002100Transcription factor, MADS-box
PfamPF003191.6E-131152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVRKKVNLQW ITKASKRRAT FRRRRDSIKK KVDELATLCG TKVGVVLYSE DQAKPLAWPN  60
DSEAKDIFKK FIDMPDLGKR FKKMQNQEEL LSTRIPKLQH QISRLERENY THEISFLLYE  120
SIDGRRPGLI NTTEKERTSL GEMVEEKIKK IKERIRQLQG VALEAHLPLQ LRSSPNQPLA  180
PCTFNEMAVV GRVPPQQQQD WVASLTTNGG ELGTIVSGAF ASSSGGVDMM HPYNMDYFSR  240
FP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVNLQWITKASKRRATFRRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G137500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1847761e-157KF184776.1 Saccharum hybrid cultivar R570 clone BAC 216L10 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021311802.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A1B6Q3190.0A0A1B6Q319_SORBI; Uncharacterized protein
STRINGSb03g011705.11e-164(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.18e-16AGAMOUS-like 36