PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G131100.1.p
Common NameDof14, Sb03g011160, SORBIDRAFT_03g011160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 513aa    MW: 54771.6 Da    PI: 9.1492
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G131100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.37.2e-38140199261
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GG++rnvP+G+grr+nk  
  Sobic.003G131100.1.p 140 PDKILPCPRCHSMETKFCYFNNYNVNQPRHFCRNCKRYWTAGGTMRNVPIGSGRRRNKDP 199
                           7899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29137197IPR003851Zinc finger, Dof-type
PfamPF027012.3E-31142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.397144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MAAPGGGLDQ DRGRGRGQDA AIKLFGRSIP VLHSSVVAAA ASEVSTKLAN DVRSNDGMSC  60
LPNMPLIVKA SPFPSKNNMK NGLQAISSQH GKMEADSKSE EVKNSLQAII SQPGKTDDSK  120
SEETKTESGG SGQEKVLKKP DKILPCPRCH SMETKFCYFN NYNVNQPRHF CRNCKRYWTA  180
GGTMRNVPIG SGRRRNKDPS HHHHVTKPCD HIVTANGDVS DATQRQSLAV KPSVLQGSGK  240
QNETACKSVS PVLNIKEQNN ADLISLVSGD NKEEKSCASS VVSGSSENWM PENTVKKEED  300
STSAYGNGVK EPDPNTQSHH AGPISVFSGN PAAVMVTNQS SADGIHGPGN GTVSPLSLPP  360
PPMVPTPGIC APAVPFPLVP AFVSCIPGWP SAVWGAAWPG SSGPTLLSLP PNSLAFSGSN  420
SRVLGKHTRV ANLQEEQKAE KKFWVPKALR IDNPEEAAKS SIWASLGIKP DERIIFKSFQ  480
SKDLKNSETK TPESLQANPA AFSRSQTFQE RT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G131100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0846380.0BT084638.2 Zea mays full-length cDNA clone ZM_BFb0150D22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455459.10.0cyclic dof factor 2
TrEMBLC5XH960.0C5XH96_SORBI; Dof-type zinc finger protein 14
STRINGSb03g011160.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-44cycling DOF factor 2
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]