PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G121400.1.p
Common NameSb03g010280, SORBIDRAFT_03g010280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 561aa    MW: 61403.5 Da    PI: 4.9047
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G121400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.5e-39181240261
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                           ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  Sobic.003G121400.1.p 181 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKNS 240
                           7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31178238IPR003851Zinc finger, Dof-type
PfamPF027014.7E-32183239IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.891185239IPR003851Zinc finger, Dof-type
PROSITE patternPS013610187223IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MSDQKDPGIK LFGRVIPLEP EPAPGTTEAE DPPPSHDQPP DELQPRAPEL AAAADEDQHN  60
EKEEKPASEM VNMPQEKDKE IKVDTPQVEK DNEMKVDAPQ KEHDDEMKID AQQEKKDEQM  120
EVNGSPMHEN IEPANLPPSE HKKEDEDLMN STEDKAASDP KGENEKTSNE ESGQDKALKK  180
PDKILPCPRC NSMDTKFCYY NNYNVNQPRH FCKNCQRYWT AGGTMRNVPV GAGRRKSKNS  240
SLHYRQLLMA PDCMLGSRVD ISKSVLPEAL VSPPAPIQPT SRNETVLKFG PEVPLCESMV  300
SALNIDEQNV NNSGSAPRGE NREDNPGPGT SYNGVPENMV HVDKNGAPVH CNGVAPVPQY  360
YLGTPFMYPW NVGWNNVPVM APGKSMPESA PASASESCST SSALWMNSPM IPASRFPSPA  420
FPYPLVPPAL WGCLSGWPVT TWNIPWIRAN GCVSPSSSSN SSCSGNGSPT LGKHSRDSNP  480
MKEEKREKSL WVPKTLRIDD PDEAAKSSIW ATLGIKPGDP GTFKPFQSKV ESKGQRSDAA  540
QVLQANPAAL SRSQTFQESS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G121400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2995600.0KF299560.1 Miscanthus sacchariflorus clone Msac_GC_7 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457611.10.0cyclic dof factor 2 isoform X1
TrEMBLC5XGH60.0C5XGH6_SORBI; Uncharacterized protein
STRINGSb03g010280.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-70cycling DOF factor 2