PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G046800.1.p
Common NameSb03g004090, SORBIDRAFT_03g004090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family G2-like
Protein Properties Length: 503aa    MW: 52726.7 Da    PI: 5.8799
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G046800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-31276331156
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                           k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sobic.003G046800.1.p 276 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 331
                           68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.27E-17273334IPR009057Homeodomain-like
PROSITE profilePS5129413.69273333IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-28274334IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-26276331IPR006447Myb domain, plants
PfamPF002491.1E-6278329IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MASSPSDLTL DYKPNGNAAA YAVTIPKPQQ EPLVDGHHHH HHLTTAEQAT QKLREFLARL  60
EEEWLKIDAF KRELPLCMQL LNHAMESYRQ QLEAYQMGSL QGAPARPLVL EEFMPLKNIG  120
IDAAAADKMG NPPSEKASWM ESAQLWNGPA AATAADMAAK GPQTPKESSE HPLPIDTLCA  180
HDAAAAGQRN GGGAFLPFAK DKTASAAEGA ALPELALAPA DKDAGDAERK PYLDASSNNG  240
VLGARRDVVQ NGVKPGTNAP EGQQAAATPP PQTHRKARRC WSPELHRRFV NALQILGGAQ  300
VATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRPMPAPP APATAAPQLV VLGGIWVPPE  360
YATQAAGQAI YGAHPATQPH YTAAVAAQEY YPSPAAVHHL QHHPAAAAAA MVHRAAAAPQ  420
QAAYKAAAAA MAGSPPGSEG RGSAGGGSVG GGGGGRERSE SIEEEGEGEE REEDDDDDDD  480
DMAAAKADGE EAAAGAGAGV KY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-13276329154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13276329154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13276329154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13276329154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-13276329255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G046800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865720.0BT086572.2 Zea mays full-length cDNA clone ZM_BFc0184N23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457252.10.0transcription factor NIGTH1
SwissprotQ5VRW21e-145NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLC5XMT50.0C5XMT5_SORBI; Uncharacterized protein
STRINGSb03g004090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-74G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]