PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G033500.1.p
Common Namedof27, Dof27, Sb03g003050, SORBIDRAFT_03g003050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 236aa    MW: 24113.6 Da    PI: 10.1796
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G033500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.93.9e-373389359
                zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                           + l+cprC+s ntkfCyynny+lsqPryfCk+CrryWt+GGalrnvPvGg +rk  
  Sobic.003G033500.1.p 33 PEGLPCPRCESVNTKFCYYNNYNLSQPRYFCKTCRRYWTRGGALRNVPVGGNTRKAT 89
                          57899*************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-233288IPR003851Zinc finger, Dof-type
PfamPF027011.7E-323688IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5183690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MVRSAAAMEA GQVPDGRALM AAVTTTGGGG REPEGLPCPR CESVNTKFCY YNNYNLSQPR  60
YFCKTCRRYW TRGGALRNVP VGGNTRKATP ATGRRKRSTP APVNVTVPAP ATASPPPPPA  120
LHGGSLLRPY GGGGGSGLLS FAAPALASPL AAADPDRRLL DFGGSFTSLI APGVADVGVH  180
FSAGFLMGGL APAALPRAPG SVAALPPPPP QQQPTVSQAL PEGMVWSMGW PDLSI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.202872e-32callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.003G033500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824180.0KC582418.1 Sorghum bicolor dof27 protein (dof27) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457194.21e-166dof zinc finger protein DOF3.4
TrEMBLA0A1B6Q1411e-165A0A1B6Q141_SORBI; Uncharacterized protein
STRINGSb03g003050.11e-161(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-32DOF zinc finger protein 1
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]