PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G421900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 485aa    MW: 51627.7 Da    PI: 6.7335
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G421900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-39104164262
                zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+ss
  Sobic.002G421900.1.p 104 PDKILPCPRCNSMDTKFCYYNNYNIKQPRHFCKSCQRYWTAGGSMRNIPVGAGRRKSKSSS 164
                           7899*****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30101161IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32106162IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.509108162IPR003851Zinc finger, Dof-type
PROSITE patternPS013610110146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MELAGAASPR PPPESHVATP RPPPQPPEKD VCEDREDMRV TGEKPCTHQE LDVDQTNSSS  60
SFNNSSECEN LAPSNDEISG SESNLEIAKT EGDVPSGEKV LKKPDKILPC PRCNSMDTKF  120
CYYNNYNIKQ PRHFCKSCQR YWTAGGSMRN IPVGAGRRKS KSSSANCRSI LIPGSSVATP  180
GGEASLFPLS INGNQAAVSF GPDSPLCNSM ASVLKIGGEQ IKSSNPASAA QPRNGENQMC  240
PPCTTSSDGP RNESQKETAN AHQNGIIGQS NGVTSVHPIP FFPGPPFVYP WSPAWNGIPT  300
MAAAVCPAPA EAANSSENCT TSSNVQWNVP PIVPVLPPGF CGPIPVPVMP PSVWPFITPW  360
PNGAWNAPWL GPSSTVPSSS PTSSSTCSES GSPVLGKHSR DSKPQGDEKA ERCLWIPKTL  420
RIDDPVEAAK SSIWTTLGIE PGDRGMFRPF QSKPERQEQI SGAARALQAN PAALSRSRSF  480
QETT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.36430.0leaf| shoot
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G421900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824050.0KC582405.1 Sorghum bicolor dof8 protein (dof8) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021309706.10.0cyclic dof factor 2 isoform X1
TrEMBLA0A1W0W7Y20.0A0A1W0W7Y2_SORBI; Uncharacterized protein
STRINGSb02g043310.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-62cycling DOF factor 2