PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G359800.1.p
Common NameSb02g038040, SORBIDRAFT_02g038040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 456aa    MW: 49063.1 Da    PI: 5.27
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G359800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.91.1e-94604502373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalkl..fse 86 
                           ++lL++cA+a++++d++l+q++L+ l+++a pdgd++qRl+a f+ AL ar +r   ++ + +a+++  +s   ++++++a++l  f++
  Sobic.002G359800.1.p  60 EQLLVHCANAIEANDATLTQQILWVLNNIAPPDGDSNQRLTAAFLCALVARASRtgACKAVTAAVAAAVESAALHVHRFTAVELasFVD 148
                           79***************************************************943444555555444444444777777777789*** PP

                  GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAee 171
                           ++P+++f++ +aN aIleaveg   vH++ ++ ++++Q p+L++ LasR+egpp lR+T+ + + s        ++ee+g +L +fA++
  Sobic.002G359800.1.p 149 LTPWHRFGYTAANAAILEAVEGFPVVHVVELGTTHCMQIPTLIDMLASRAEGPPILRLTVADVAPSApppaLDMSYEELGAKLVNFARS 237
                           ************************************************************9886666788778899************* PP

                  GRAS 172 lgvpfefnvl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles......erdevLklvkslsPkvvvvveqead 247
                            +++++f+v+       +++ +++l++++L ++  Eal+Vn+++ lh+++de++ + s       r+ +Lk +++l P++vvvve++ad
  Sobic.002G359800.1.p 238 RNMSMDFRVVptspadaLTSLVDQLRVQQLVLDGTEALVVNCHMLLHTVPDETAGSVSltqpvsLRTMLLKSLRTLDPNLVVVVEEDAD 326
                           **********888777666677888999999999****************998777665557767899********************* PP

                  GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                            ++++ + r+  a+++ +  +d++++ lp+ se+r+++E+e +g++++nv+a+eg er+er+e  ++W +r+++aGF++v+++e+aa +
  Sobic.002G359800.1.p 327 FTAGDVVGRLRAAFNFLWIPYDAVDTFLPKGSEQRRWYEAE-IGWKVENVLAQEGVERVERQEDRGRWGQRMRSAGFRAVAFGEEAAGE 414
                           *****************************************.*********************************************** PP

                  GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           +k++l++++  g+ ++ e++ lvl+Wk++++v++SaW
  Sobic.002G359800.1.p 415 VKAMLNEHA-AGWGMKREDDDLVLTWKGHNVVFASAW 450
                           *********.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.48333432IPR005202Transcription factor GRAS
PfamPF035143.9E-9260450IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MMQFTHTAPP PPPHAAGGLG LGLFLDVGAP RAARGPWPGS FPTPASKISL GNLNSTSCME  60
QLLVHCANAI EANDATLTQQ ILWVLNNIAP PDGDSNQRLT AAFLCALVAR ASRTGACKAV  120
TAAVAAAVES AALHVHRFTA VELASFVDLT PWHRFGYTAA NAAILEAVEG FPVVHVVELG  180
TTHCMQIPTL IDMLASRAEG PPILRLTVAD VAPSAPPPAL DMSYEELGAK LVNFARSRNM  240
SMDFRVVPTS PADALTSLVD QLRVQQLVLD GTEALVVNCH MLLHTVPDET AGSVSLTQPV  300
SLRTMLLKSL RTLDPNLVVV VEEDADFTAG DVVGRLRAAF NFLWIPYDAV DTFLPKGSEQ  360
RRWYEAEIGW KVENVLAQEG VERVERQEDR GRWGQRMRSA GFRAVAFGEE AAGEVKAMLN  420
EHAAGWGMKR EDDDLVLTWK GHNVVFASAW APSPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-543845366475Protein SHORT-ROOT
5b3h_B9e-553845312421Protein SHORT-ROOT
5b3h_E9e-553845312421Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G359800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0676930.0BT067693.1 Zea mays full-length cDNA clone ZM_BFc0127K06 mRNA, complete cds.
GenBankKJ7279410.0KJ727941.1 Zea mays clone pUT6037 GRAS transcription factor (GRAS11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460950.10.0scarecrow-like protein 32
SwissprotQ9SN221e-165SCL32_ARATH; Scarecrow-like protein 32
TrEMBLC5XD470.0C5XD47_SORBI; Uncharacterized protein
STRINGSb02g038040.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-148GRAS family protein