PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G354900.1.p
Common NameSb02g037650, SORBIDRAFT_02g037650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 548aa    MW: 60131.9 Da    PI: 6.1225
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G354900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS431.66.2e-1321775461373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l+elL++cA+av+ ++  +++ ++ +l++ +s +g+p++Rl ay++e+L arla s+s++ykal+++e +   ss+ l+++++++e++P
  Sobic.002G354900.1.p 177 LKELLIACARAVEYNNSYAIDLMIPELRKKVSVSGEPLERLGAYMVEGLVARLAASGSSIYKALKCKEPR---SSDLLSYMHFLYEACP 262
                           5799*****************************************************************9...9*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++kf+++ aN aI eav+ge+r+HiiDf i qG+QW++LlqaLa+Rp+gpp +RiTg++++ s   +   le +g+rL+++A   +vpf
  Sobic.002G354900.1.p 263 YFKFGYMSANGAIAEAVKGEDRIHIIDFHIAQGAQWISLLQALAARPGGPPFVRITGIDDSVSAyaRGGGLELVGRRLSHIAGLYKVPF 351
                           ************************************************************888899999******************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +f++ va + +++e  +L + pgEa+aVn+ l+lh+++de+vs++++rd++L+lvk+lsPkv+++veqe+++n+++F++rf+e+l+yy+
  Sobic.002G354900.1.p 352 QFDA-VAISSSEVEEGHLGIVPGEAVAVNFTLELHHIPDETVSTANHRDRILRLVKGLSPKVLTLVEQESNTNTAPFAQRFAETLDYYT 439
                           ****.6888999***************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           a+f+s++  lpr+++eri++E+++l+reivn+vaceg+er+erhe ++kW++rl++aGF+p pls  +++++k+ll+ ++ d y++ e+
  Sobic.002G354900.1.p 440 AIFESIDLALPRDDRERINIEQHCLAREIVNLVACEGEERVERHEVFGKWKARLMMAGFRPSPLSALVNATIKTLLQSYSPD-YKLAER 527
                           ********************************************************************************66.****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +g l+lgWk+rpL++ SaW
  Sobic.002G354900.1.p 528 DGVLYLGWKNRPLIVSSAW 546
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.171151528IPR005202Transcription factor GRAS
PfamPF035142.1E-129177546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MADTPTSRMV HPFGDVPRQT PKQFLYSGNS QHLCYPYQSA SDTHVVPQRH CTMRSHSPDA  60
GSEDHDNHKQ YTLDSSATSG CSRHDSPSSQ SVHAGSGSPV SLEDSHSGST NGNGSPVSAS  120
CVTEDPTDLK QKLKDLEAAM LGTDPEIVNS LEISIADQLS LEPEEWKHMM SMPGGNLKEL  180
LIACARAVEY NNSYAIDLMI PELRKKVSVS GEPLERLGAY MVEGLVARLA ASGSSIYKAL  240
KCKEPRSSDL LSYMHFLYEA CPYFKFGYMS ANGAIAEAVK GEDRIHIIDF HIAQGAQWIS  300
LLQALAARPG GPPFVRITGI DDSVSAYARG GGLELVGRRL SHIAGLYKVP FQFDAVAISS  360
SEVEEGHLGI VPGEAVAVNF TLELHHIPDE TVSTANHRDR ILRLVKGLSP KVLTLVEQES  420
NTNTAPFAQR FAETLDYYTA IFESIDLALP RDDRERINIE QHCLAREIVN LVACEGEERV  480
ERHEVFGKWK ARLMMAGFRP SPLSALVNAT IKTLLQSYSP DYKLAERDGV LYLGWKNRPL  540
IVSSAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-651815478375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G354900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639280.0BT063928.1 Zea mays full-length cDNA clone ZM_BFc0120M18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460928.10.0chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLC5XCH40.0C5XCH4_SORBI; Uncharacterized protein
STRINGSb02g037650.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Representative plantOGRP14091447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]
  3. Tanabe S, et al.
    The elicitor-responsive gene for a GRAS family protein, CIGR2, suppresses cell death in rice inoculated with rice blast fungus via activation of a heat shock transcription factor, OsHsf23.
    Biosci. Biotechnol. Biochem., 2016. 80(1): p. 145-51
    [PMID:26287768]