PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G330300.1.p
Common NameSb02g035680, SORBIDRAFT_02g035680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 571aa    MW: 64509.2 Da    PI: 6.2516
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G330300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4232.5e-1292005692373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                           ++lL++cAea+s++  e+  +l+++ +  +s +g+p+qRl ay++e+L ar a+s++++y+al+++e +   s e l+++k++++++P+
  Sobic.002G330300.1.p 200 KQLLTKCAEALSEERIEEFLTLVQQARGVVSITGEPIQRLGAYLLEGLVARHANSGTNIYRALKCREPE---SNELLSYMKILYNICPY 285
                           689*****************************************************************9...99*************** PP

                  GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                           +kf++++aN aI ea+ +e+++HiiDf+i qG+QW++L+qaLa++p+gpp++RiTg+++p s+  + e l  +g+ L+++ ee+++p+e
  Sobic.002G330300.1.p 286 FKFGYMAANGAIAEALRNEDKIHIIDFQIAQGTQWITLIQALAAKPGGPPHVRITGIDDPVSEyaRGEGLDLVGKMLKSMSEEFRIPLE 374
                           ************************************************************999999*********************** PP

                  GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                           f++l     ++++ e+L+++pgEalaVn+ lqlh+++desv+++++rd +L++vk+lsPkv ++veqe+ +n+++Fl rf+e+l+yysa
  Sobic.002G330300.1.p 375 FTPLPGIYATQVTKEMLDIRPGEALAVNFTLQLHHTPDESVDVSNPRDGLLRMVKGLSPKVTTLVEQESHTNTTPFLMRFTETLDYYSA 463
                           ***97779999****************************************************************************** PP

                  GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                           +f+s++a+lpre++eri+vE+++l+++ivn++aceg++r+erhe l+kWr+rl++aGF+p+pls+++++ ++ ll+ ++ d y++ee++
  Sobic.002G330300.1.p 464 MFESIDANLPRENKERINVEQHCLAKDIVNIIACEGKDRVERHELLGKWRSRLTMAGFRPYPLSSYVNSVIRNLLAYYS-DKYTLEEKD 551
                           ****************************************************************************999.55******* PP

                  GRAS 356 gslvlgWkdrpLvsvSaW 373
                           g+++lgWk+r+L+s+SaW
  Sobic.002G330300.1.p 552 GAMLLGWKNRKLISASAW 569
                           ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.601173551IPR005202Transcription factor GRAS
PfamPF035148.5E-127200569IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MDLHQLLKYR LTGANVFYEF PTENNLANTP WPASPLKSEF SGSPYTPLSS QLECDNLSAL  60
SNTPDNQSST ETISAQPISP LEVDSSYRQA AILRENTQVR PDPLYATSRH NMQHALREIE  120
TVLMAPDAED AATSTKHEFE EHKPAQLMRQ RSRTWSHESR QPSPGVVRTQ FASGYPTASY  180
EFRPEKRLRE LREDPQSMVK QLLTKCAEAL SEERIEEFLT LVQQARGVVS ITGEPIQRLG  240
AYLLEGLVAR HANSGTNIYR ALKCREPESN ELLSYMKILY NICPYFKFGY MAANGAIAEA  300
LRNEDKIHII DFQIAQGTQW ITLIQALAAK PGGPPHVRIT GIDDPVSEYA RGEGLDLVGK  360
MLKSMSEEFR IPLEFTPLPG IYATQVTKEM LDIRPGEALA VNFTLQLHHT PDESVDVSNP  420
RDGLLRMVKG LSPKVTTLVE QESHTNTTPF LMRFTETLDY YSAMFESIDA NLPRENKERI  480
NVEQHCLAKD IVNIIACEGK DRVERHELLG KWRSRLTMAG FRPYPLSSYV NSVIRNLLAY  540
YSDKYTLEEK DGAMLLGWKN RKLISASAWH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-681835693378Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.192020.0ovary
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G330300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0419700.0BT041970.1 Zea mays full-length cDNA clone ZM_BFb0091M24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460825.10.0chitin-inducible gibberellin-responsive protein 1
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLC5XAU20.0C5XAU2_SORBI; Uncharacterized protein
STRINGSb02g035680.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106313643
Representative plantOGRP8948915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]