PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G316500.4.p
Common NameSb02g034550, SORBIDRAFT_02g034550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 753aa    MW: 84373.7 Da    PI: 4.9125
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G316500.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.72.3e-1003737433373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+a+s++d   a  lL ++++++sp+gd++qRla++f+ +L+arla+++s++yk+l +++ts   +++ l+a++l+  v+ + 
  Sobic.002G316500.4.p 373 TLLIHCAQAISTDDRWSAAMLLGKIKQHSSPRGDANQRLAHCFADGLEARLAGTGSQVYKSLMSKRTS---QVDILKAYQLYLTVCCFK 458
                           69************************************************************999999...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                            +++   N +I + + g +++Hi+D+++  G+QWp++l  L++ ++gpp++RiTg++ p++g   +  +ee+g+rL+k A+++g+pf+f
  Sobic.002G316500.4.p 459 MMAYKFSNMTIANVIGGRRKLHIVDYGMRDGIQWPSFLGILSTWEGGPPEVRITGIDLPQPGfrPAAHIEEIGRRLSKCARQFGIPFKF 547
                           *************************************************************9*9************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +  +a ++e++++++L+++p+Eal++n  +   +l+de v++ s  +rd vL+ +++++P+v+++++ + +h+++ F++rf e l ++s
  Sobic.002G316500.4.p 548 QS-IAAKWEMVSVDDLNIDPDEALIINGLFDFGNLMDEGVDIYSpsPRDMVLNNIREMRPDVFIFCNVNGSHGTPFFVTRFREVLFFFS 635
                           **.799**********************************9988779****************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd+l++++pr+++ r  +Er+l+gr ++nv+aceg++r+erhet+++W+ r ++aG+k++pl+ +++k ++  ++  + + + ++ +
  Sobic.002G316500.4.p 636 ALFDMLDVTVPRDNDRRLLIERVLFGRFAMNVIACEGSDRVERHETYKQWQVRNHRAGLKQLPLDPDIVKVVRNKVKDSYHKDFVIDMD 724
                           ********************************************************************************888****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +++l+ gWk+r + ++S W
  Sobic.002G316500.4.p 725 HQWLLEGWKGRIICAMSTW 743
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.294345724IPR005202Transcription factor GRAS
PfamPF035148.0E-98373743IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MAGTPEEFPV QGGPEPEPFS PSVFLDLPPT PSEEDPPAST DDLALTFISR ILMEEDIDEK  60
FLYHYPDHPE LLQAQQPFAQ ILSDAGASSD FFATNNDGSG ACTLPPSSDV PALANTTWPF  120
DPVEFPQLFL SSPCPDMGVG IGEFTADDAN RFLLPQQDAA SARFQRADKA SSFRNCGSAG  180
IQCSELLAGP EEETTTSTTS SPPTGDREHG ALASTFFSGQ NRVNIDMLNQ AFLRGMEEAK  240
KFLPIDSSLL VEARGCKPPQ VFIPGHARNE DKVDRMLTFQ GISNARGRKK WCNWQDLEST  300
EMSRNSKLMA LAELEETDEI IDEIILNEYR LCLNGMLGLD ITMDSKDGNF VRKGNWKSAL  360
RRRSLNEAVD FHTLLIHCAQ AISTDDRWSA AMLLGKIKQH SSPRGDANQR LAHCFADGLE  420
ARLAGTGSQV YKSLMSKRTS QVDILKAYQL YLTVCCFKMM AYKFSNMTIA NVIGGRRKLH  480
IVDYGMRDGI QWPSFLGILS TWEGGPPEVR ITGIDLPQPG FRPAAHIEEI GRRLSKCARQ  540
FGIPFKFQSI AAKWEMVSVD DLNIDPDEAL IINGLFDFGN LMDEGVDIYS PSPRDMVLNN  600
IREMRPDVFI FCNVNGSHGT PFFVTRFREV LFFFSALFDM LDVTVPRDND RRLLIERVLF  660
GRFAMNVIAC EGSDRVERHE TYKQWQVRNH RAGLKQLPLD PDIVKVVRNK VKDSYHKDFV  720
IDMDHQWLLE GWKGRIICAM STWVADDAFS EH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-443757438374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, leaves and flowers, and in the elongation zone in root. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G316500.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.10.0scarecrow-like protein 34
SwissprotO809331e-145SCL9_ARATH; Scarecrow-like protein 9
TrEMBLC5X9Z60.0C5X9Z6_SORBI; Uncharacterized protein
STRINGSb02g034550.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-147GRAS family protein