PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G316500.2.p
Common NameSb02g034550, SORBIDRAFT_02g034550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 773aa    MW: 86511.2 Da    PI: 4.9553
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G316500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.62.5e-1003937633373
                  GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL++cA+a+s++d   a  lL ++++++sp+gd++qRla++f+ +L+arla+++s++yk+l +++ts   +++ l+a++l+  v+ + 
  Sobic.002G316500.2.p 393 TLLIHCAQAISTDDRWSAAMLLGKIKQHSSPRGDANQRLAHCFADGLEARLAGTGSQVYKSLMSKRTS---QVDILKAYQLYLTVCCFK 478
                           69************************************************************999999...9***************** PP

                  GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                            +++   N +I + + g +++Hi+D+++  G+QWp++l  L++ ++gpp++RiTg++ p++g   +  +ee+g+rL+k A+++g+pf+f
  Sobic.002G316500.2.p 479 MMAYKFSNMTIANVIGGRRKLHIVDYGMRDGIQWPSFLGILSTWEGGPPEVRITGIDLPQPGfrPAAHIEEIGRRLSKCARQFGIPFKF 567
                           *************************************************************9*9************************* PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           +  +a ++e++++++L+++p+Eal++n  +   +l+de v++ s  +rd vL+ +++++P+v+++++ + +h+++ F++rf e l ++s
  Sobic.002G316500.2.p 568 QS-IAAKWEMVSVDDLNIDPDEALIINGLFDFGNLMDEGVDIYSpsPRDMVLNNIREMRPDVFIFCNVNGSHGTPFFVTRFREVLFFFS 655
                           **.799**********************************9988779****************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           alfd+l++++pr+++ r  +Er+l+gr ++nv+aceg++r+erhet+++W+ r ++aG+k++pl+ +++k ++  ++  + + + ++ +
  Sobic.002G316500.2.p 656 ALFDMLDVTVPRDNDRRLLIERVLFGRFAMNVIACEGSDRVERHETYKQWQVRNHRAGLKQLPLDPDIVKVVRNKVKDSYHKDFVIDMD 744
                           ********************************************************************************888****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaW 373
                           +++l+ gWk+r + ++S W
  Sobic.002G316500.2.p 745 HQWLLEGWKGRIICAMSTW 763
                           ******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.294365744IPR005202Transcription factor GRAS
PfamPF035148.5E-98393763IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MAPLWLPPPQ SYPTPSTKSG MAGTPEEFPV QGGPEPEPFS PSVFLDLPPT PSEEDPPAST  60
DDLALTFISR ILMEEDIDEK FLYHYPDHPE LLQAQQPFAQ ILSDAGASSD FFATNNDGSG  120
ACTLPPSSDV PALANTTWPF DPVEFPQLFL SSPCPDMGVG IGEFTADDAN RFLLPQQDAA  180
SARFQRADKA SSFRNCGSAG IQCSELLAGP EEETTTSTTS SPPTGDREHG ALASTFFSGQ  240
NRVNIDMLNQ AFLRGMEEAK KFLPIDSSLL VEARGCKPPQ VFIPGHARNE DKVDRMLTFQ  300
GISNARGRKK WCNWQDLEST EMSRNSKLMA LAELEETDEI IDEIILNEYR LCLNGMLGLD  360
ITMDSKDGNF VRKGNWKSAL RRRSLNEAVD FHTLLIHCAQ AISTDDRWSA AMLLGKIKQH  420
SSPRGDANQR LAHCFADGLE ARLAGTGSQV YKSLMSKRTS QVDILKAYQL YLTVCCFKMM  480
AYKFSNMTIA NVIGGRRKLH IVDYGMRDGI QWPSFLGILS TWEGGPPEVR ITGIDLPQPG  540
FRPAAHIEEI GRRLSKCARQ FGIPFKFQSI AAKWEMVSVD DLNIDPDEAL IINGLFDFGN  600
LMDEGVDIYS PSPRDMVLNN IREMRPDVFI FCNVNGSHGT PFFVTRFREV LFFFSALFDM  660
LDVTVPRDND RRLLIERVLF GRFAMNVIAC EGSDRVERHE TYKQWQVRNH RAGLKQLPLD  720
PDIVKVVRNK VKDSYHKDFV IDMDHQWLLE GWKGRIICAM STWVADDAFS EH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-443957638374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462924.10.0hypothetical protein SORBIDRAFT_02g034550
TrEMBLC5X9Z60.0C5X9Z6_SORBI; Putative uncharacterized protein Sb02g034550
STRINGSb02g034550.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-146GRAS family protein