PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G313800.1.p
Common Namedof6, Dof6, Sb02g034320, SORBIDRAFT_02g034320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 355aa    MW: 34828.7 Da    PI: 8.0567
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G313800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.6e-3943102362
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s+
  Sobic.002G313800.1.p  43 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSR 102
                           57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-3345100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.38546100IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-274699IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAGAGGATAV QQPAAGAPAA AGGAARSGVG AGAAGAPVAD PRAEALRCPR CDSANTKFCY  60
YNNYSLSQPR HFCKACKRYW TRGGTLRNVP VGGGCRKNKR SRSSGGAGGR NGSSSSASAA  120
AAAVTSSSAA STLSLPPPTG SLPSLTSALG LPGGASLASL LLGTAGSGGD HLGLFQAAMQ  180
SVVSSEATAY EMQQQQSQVD HLLGLGYGGA TGAGAQIHLK PWMQEAAGAG GIMDSFYAPL  240
LSSSLVPGLE ELHVKAEVAG AGDHQQKPAP GDQQSASWEL PTPSSSNVDA NVIASDALMA  300
AAAASMNPAV SSSTSTAPTT VPSSFMYWGN GGIGGAAAAW PDLANCGSSI ATLF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G313800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824030.0KC582403.1 Sorghum bicolor dof6 protein (dof6) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460750.10.0dof zinc finger protein DOF2.4
TrEMBLC5X9D90.0C5X9D9_SORBI; Dof-type zinc finger protein 6
STRINGSb02g034320.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-32TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]