PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G301800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRAS
Protein Properties Length: 831aa    MW: 91560.3 Da    PI: 4.8305
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G301800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.54.7e-1034498211373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++ L++cA+ v++gd + a+++L+++++++sp+gd++qRla++f+ +L+arla+++s+ y++l +++ts   +++ l+a++l++ ++ 
  Sobic.002G301800.1.p 449 LRTMLIHCAQSVATGDRRSATEVLKQIKQHSSPRGDATQRLAHCFAMGLEARLAGTGSQAYQSLMAQHTS---VVDFLKAYRLYVAACC 534
                           5789************************************************************999999...**************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++k+ ++    ++++av g +++Hi+ +++++G+Q+p L++ La R++gpp++R+T+++ p++g   ++++eetg+rL+++A+e+gvpf
  Sobic.002G301800.1.p 535 FMKVNFIFSHMTVVNAVVGRSKLHIVEYGVQHGFQYPGLFHLLARREGGPPEVRVTAIAVPQPGfrPAHQIEETGRRLSNIAREMGVPF 623
                           ***************************************************************9*9*********************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                           +f+  +a ++e+++ ++L+++p+E+l+Vn+   + +l+desv ++s  +rd+vL+ +++++P+v++++  +  ++++ Fl+rf eal +
  Sobic.002G301800.1.p 624 KFRG-IAAKWEAVRAKDLNLDPDEVLVVNSECYIGNLMDESVLVDSpsPRDTVLNNIREMRPNVFIHTVVNGTYGAPFFLTRFREALFF 711
                           ****.799*********************************98877779**************************************** PP

                  GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                           +sa fd+++a++pr++ er  +Er ++g  ++nv+acega+r+er et+++W+ r ++aG++++pl+ +++k a+  ++ ++ + + v+
  Sobic.002G301800.1.p 712 FSAQFDMIDATIPRDNAERLLIERNIFGSFAMNVIACEGADRVERPETYKQWQVRNHRAGLRQLPLNPEVVKAARDKVKIYYHRDFLVD 800
                           **********************************************************************************999**** PP

                  GRAS 353 eesgslvlgWkdrpLvsvSaW 373
                           e++ +l+lgWk+r L+++S W
  Sobic.002G301800.1.p 801 EDNRWLLLGWKGRVLYAMSTW 821
                           ********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.206423802IPR005202Transcription factor GRAS
PfamPF035141.6E-100449821IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MSATPEDFLA AQEGAAPYLA AQEPFSPSVF LDLPPTPPGR PTHDHDDDDD DDPDLVLPFI  60
SRMLMEEDID DKFFYQFPDH PALLTAQQPY AQILSDSATA SSPSEDSSNA AATATTTSSS  120
GTSRTAGVNS TLSPSYDAPA SSPDPASWPP YDDPVYLSDL LRSPPYPSPD MGVGLDDFAG  180
LLSPAAQGQD AAPAARFDFQ QSPPFSDGGE GGGGEEDQRQ QPSFAAQRTG GAQHQRGSQS  240
SAAFSSDKDE EEETKTESTT FPAADADHAA LASAFFGAQN EGNMDMLNMA FLKGMEEAKK  300
FLPTTNSLLI DLDEPSGKSL PKDRHSKTST DFAATQVQVK EEEEQVVNAI SIFGGSRSAN  360
GRGRKNRHAE EDDLEAETGR SSKLMMPEQE ETGANELYNE IMNCTYESFL KRMDDLRIAM  420
GSETEKSARK VSRKGARGKQ SLVNEVVDLR TMLIHCAQSV ATGDRRSATE VLKQIKQHSS  480
PRGDATQRLA HCFAMGLEAR LAGTGSQAYQ SLMAQHTSVV DFLKAYRLYV AACCFMKVNF  540
IFSHMTVVNA VVGRSKLHIV EYGVQHGFQY PGLFHLLARR EGGPPEVRVT AIAVPQPGFR  600
PAHQIEETGR RLSNIAREMG VPFKFRGIAA KWEAVRAKDL NLDPDEVLVV NSECYIGNLM  660
DESVLVDSPS PRDTVLNNIR EMRPNVFIHT VVNGTYGAPF FLTRFREALF FFSAQFDMID  720
ATIPRDNAER LLIERNIFGS FAMNVIACEG ADRVERPETY KQWQVRNHRA GLRQLPLNPE  780
VVKAARDKVK IYYHRDFLVD EDNRWLLLGW KGRVLYAMST WVAEDNKPIF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-364538218374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.196240.0ovary| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677824.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK7U8D60.0K7U8D6_MAIZE; Uncharacterized protein
STRINGGRMZM2G163427_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-145GRAS family protein