PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G268600.1.p
Common NameSb02g030260, SORBIDRAFT_02g030260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family TCP
Protein Properties Length: 327aa    MW: 33537.3 Da    PI: 4.9088
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G268600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1004.3e-31681637102
                   TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaa 95 
                           r  ++hTkv+gR+RR+R+ a c  r+  L++eLG+++d++ti WLlqq++pai+++tgt++ +a +++ ++ +    ++ +++  +  +
  Sobic.002G268600.1.p  68 RYRDRHTKVEGRGRRIRMAAACSDRVSRLTRELGHKSDGETIRWLLQQSEPAIIAATGTGTVPAIAVTGADGVLRLPAEPAAADGAGGE 156
                           678********************************************************777775554444444444222221111111 PP

                   TCP  96 kskksqk 102
                           +++++q+
  Sobic.002G268600.1.p 157 QQQQQQE 163
                           1111111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136922.1769123IPR017887Transcription factor TCP subgroup
PfamPF036341.5E-2470133IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MESRAAGRGE EGTKALYLGN GSAAGAVAVD AMVSMEAGGS GLPKPEPVSV EFLSGGGLQV  60
SNPRPPPRYR DRHTKVEGRG RRIRMAAACS DRVSRLTREL GHKSDGETIR WLLQQSEPAI  120
IAATGTGTVP AIAVTGADGV LRLPAEPAAA DGAGGEQQQQ QQEPDAKRRR KLQPTRGAGA  180
GPGPAAPAPA AAYYPVVADP LLQANGGGAI SVSSGLAPAS APAPVGAIPF IAIPAPSPGA  240
TGERKQMIPP PAAMWMVPQQ AGAANQPTHY WAFPTNPEFL NFQQQAVYDG GQLVGDGESQ  300
GQQTGGYQPW EGEDEEIAVT DSSSEE*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings and leaves, mostly in the lower region rich in dividing cells. {ECO:0000269|PubMed:9338963}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G268600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462687.10.0transcription factor PCF2
SwissprotA2YXQ19e-78PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH69e-78PCF2_ORYSJ; Transcription factor PCF2
TrEMBLC5X6210.0C5X621_SORBI; Uncharacterized protein
STRINGSb02g030260.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Representative plantOGRP31781129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.23e-33TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]