PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G264100.1.p
Common NameSb02g029870, SORBIDRAFT_02g029870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family bZIP
Protein Properties Length: 393aa    MW: 42258.9 Da    PI: 6.8452
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G264100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.4e-10183241563
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                           kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Sobic.002G264100.1.p 183 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLALLQRDTTGLTTEN 241
                           9********************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16179243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852181244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-10183237No hitNo description
SuperFamilySSF579599.85E-11183235No hitNo description
PfamPF001705.8E-9183240IPR004827Basic-leucine zipper domain
CDDcd147035.03E-23184233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MNKDKAPMPG DGGPSDGLPP QSTRRAGAPP SSSTPPPEYD ISRMPDFPTR STGHRRAHSE  60
ILGLPDDLDL SAPGGGDGPS LSDENDEELF SMFLDVDKLN SSCGASSEAE AESSSAAGGG  120
GEGAELGHAP RPRHQHSQSM DESMSIKAEQ LVGAPGMEGM SSAEAKKAVS AAKLAELALV  180
DPKRAKRIWA NRQSAARSKE RKMRYIAELE RKVQTLQTEA TTLSAQLALL QRDTTGLTTE  240
NSELKVRLQT MEQQVHLQDA LNDTLKAEVQ RLKVATGQVA NGGGGMMNFG AMPRSFGGNQ  300
QMFHNNQAMQ SMLATHQLQQ LQLHSQPQQQ SQHSQHQHQH QQLHSIQAQQ QQQQLHSLQA  360
QQLQQVARDL KMKAHLAGQG QWGDGKSGSS GS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.148550.0callus
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G264100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9599490.0EU959949.1 Zea mays clone 220819 transcription factor RF2a mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462662.10.0transcription factor RF2a
SwissprotQ69IL41e-164RF2A_ORYSJ; Transcription factor RF2a
TrEMBLC5X5E50.0C5X5E5_SORBI; Uncharacterized protein
STRINGSb02g029870.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.16e-79bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]