PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G236600.2.p
Common NameDof7, Sb02g027480, SORBIDRAFT_02g027480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Dof
Protein Properties Length: 253aa    MW: 25792.8 Da    PI: 9.4633
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G236600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-3645101662
                zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +cprC +++tkfCyynny++sqPr+fCk+CrryWtkGG+lrnvPvGgg+rk+ +ss
  Sobic.002G236600.2.p  45 DPCPRCGARDTKFCYYNNYNTSQPRHFCKSCRRYWTKGGSLRNVPVGGGTRKSSSSS 101
                           57**************************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-234496IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.3234599IPR003851Zinc finger, Dof-type
PfamPF027016.3E-314699IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MQEHGRRPVT PFAGVDLRRP KGYPAPAAVA AAKEAAPARA PVVGDPCPRC GARDTKFCYY  60
NNYNTSQPRH FCKSCRRYWT KGGSLRNVPV GGGTRKSSSS STSSPSATTS ASPGGAAPKN  120
TKRSKNSKRR RVAPAPDPAA PGTDAPTVTA TATADVANTA PSTEAAAATV AASEKPVTMT  180
EEEPAAAVVV ATETKPPAAP GLGLADAGSG GGGKELLPDP SHFEWPSGCD LGSYWGTSVF  240
ADTDPALFLN LP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127131KRRRV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.93186e-51root| shoot
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00672SELEXTransfer from GRMZM2G009406Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G236600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824040.0KC582404.1 Sorghum bicolor dof7 protein (dof7) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460395.21e-179dof zinc finger protein MNB1A
TrEMBLC5X3461e-179C5X346_SORBI; Dof-type zinc finger protein 7
STRINGSb02g027480.11e-180(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-27DOF zinc finger protein 1
Publications ? help Back to Top
  1. Kushwaha H,Gupta S,Singh VK,Rastogi S,Yadav D
    Genome wide identification of Dof transcription factor gene family in sorghum and its comparative phylogenetic analysis with rice and Arabidopsis.
    Mol. Biol. Rep., 2011. 38(8): p. 5037-53
    [PMID:21161392]