PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G231100.1.p
Common NameSb02g027040, SORBIDRAFT_02g027040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 303aa    MW: 31467.2 Da    PI: 7.7836
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G231100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.41.3e-3173124557
           ZF-HD_dimer   5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                           rY+eClkNhA+ +GghavDGCgEfmp+ geegt +al+CaAC+CHRnFHR+e+
  Sobic.002G231100.1.p  73 RYRECLKNHAVGIGGHAVDGCGEFMPA-GEEGTLDALRCAACNCHRNFHRKES 124
                           8*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015662.0E-3073123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-2973124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2473124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.06874123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.63E-21227300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-33230301IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-26239295IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDFDDHDDGD EEMAPMPVSS SYEAPPLAVA AGGFAGGVAA APKPPVGEPG GGRASKAPSG  60
LGLGGLHGAG GGRYRECLKN HAVGIGGHAV DGCGEFMPAG EEGTLDALRC AACNCHRNFH  120
RKESPAAAEG SPISSAALVA YGGTPHQHHH FSPYYRTPAG AGYFHHHHHQ QPPPLHHMAH  180
TPRPLALPST SPHSGRDDGD DLSGMPMSAM GPLTLSGMSL GGSGGAGPSG GSGGSGSGKK  240
RFRTKFTQEQ KDKMLAFAER VGWRIQKHDE AAVQQFCDEV GVKRHVLKVW MHNNKHTLGK  300
KP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-292402971875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9747751e-100EU974775.1 Zea mays clone 457946 mRNA sequence.
GenBankEU9726551e-100EU972655.1 Zea mays clone 385315 ZF-HD protein dimerisation region containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460367.10.0hypothetical protein SORBIDRAFT_02g027040
SwissprotA2Z2591e-122ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLC5X2Z80.0C5X2Z8_SORBI; Putative uncharacterized protein Sb02g027040
STRINGSb02g027040.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-56homeobox protein 21