PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G201100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family ZF-HD
Protein Properties Length: 111aa    MW: 12461.1 Da    PI: 8.4964
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G201100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.21.2e-304097260
           ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                          ++v+Y+eC++NhAas+Gg+a+DGC+Ef+++ gee+t+ alkCaACgCHR+FHRr +++e
  Sobic.002G201100.2.p 40 CSVHYRECRRNHAASTGGYAIDGCREFIAE-GEESTSGALKCAACGCHRSFHRRVQVYE 97
                          789**************************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-2422101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.9E-294294IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-234392IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2044493IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MQRGSSCAES KAWLERGRKL TMKRLLIMRR CEPIVRFTCC SVHYRECRRN HAASTGGYAI  60
DGCREFIAEG EESTSGALKC AACGCHRSFH RRVQVYEVAW DYGSDTSSTE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9741561e-107EU974156.1 Zea mays clone 441364 mini zinc finger 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152181.11e-53mini zinc finger 3
SwissprotQ6ER221e-31MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBLK3ZY943e-58K3ZY94_SETIT; Uncharacterized protein
STRINGSi031576m8e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-24mini zinc finger 2