PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G050700.2.p
Common NameSb02g004250, SORBIDRAFT_02g004250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family CPP
Protein Properties Length: 777aa    MW: 83360.1 Da    PI: 6.4021
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G050700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.24.9e-16462500240
                   TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Sobic.002G050700.2.p 462 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 500
                           589**********************************96 PP

2TCR49.58.1e-16547586140
                   TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                           ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Sobic.002G050700.2.p 547 RHKRGCNCKKSSCLKKYCECYQGGVGCSTNCRCESCKNTF 586
                           589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17461502IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.911462587IPR005172CRC domain
PfamPF036388.8E-12464499IPR005172CRC domain
SMARTSM011145.1E-16547588IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.7E-11549585IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MDTPDRAAAP SAASRAEDSP VFSFLNNLSP IEPLKSAYNT NSLQGFQSIN ITSISSIFTS  60
PHDNVNKEPR LPKSSLGDIS ENEVCADGAD TNKPSKSSNA VRLFACTSTV TRETHSVTCS  120
GVVDPPTGPC DLAQPGQFDN GSPDHNTTPC HGVRSDLKLD KTRKLEAAQT VKNTLEKRKC  180
LFSTDIQLLD GSSEPVNDND QVLGCEWSDL ISTTSAELLA FDSTMDEHHR GVHLAAKNAE  240
SCGYLLSKLT GDGDVSDRAH PSASGQVYYQ ELVMGEDQTE NAEIFQDGQE TISTEEIQDN  300
ICEANGCLPL EYKVEGQQQR GVRRRCLVFE ASGFSNSVVK KGTVENLSVS TCKGKSPVQT  360
QPRGLRGIGL HLNALALTPK GKMACQDPTA SALLPSSASE KDVHGRLLSA GENFTHSGGE  420
LLEFPVDDCS AGGFPVNDHV SGQSVSPQKK RRKTDNGDDG EACKRCSCKK SKCLKLYCEC  480
FAAGVYCSEP CSCQGCLNKP IHEEIVLSTR KQIEFRNPLA FAPKVIRMSD AGLETGEDPN  540
NTPASARHKR GCNCKKSSCL KKYCECYQGG VGCSTNCRCE SCKNTFGRRD AESELTEEMK  600
QESEQTENCS QEKENGQQKA NVQSEDHPLL DLVPITPPFD LSSSLLKLPN FSSAKPPRPS  660
KPRSVNSRSS ASKATATVQP CKSSKIAVSG IDEEMPDILK EPNSPSNCVK TTSPNGKRVS  720
PPHNALSVSP NRKGGRKLIL KSIPSFPSLA GDTISGSAMN NTDSTFSVSP LTLGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1546658414120Protein lin-54 homolog
5fd3_B8e-1546658414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448452KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.002G050700.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459413.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A1W0W2E20.0A0A1W0W2E2_SORBI; Uncharacterized protein
STRINGSb02g004250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-77TESMIN/TSO1-like CXC 2