PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G534300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family Trihelix
Protein Properties Length: 782aa    MW: 82009.9 Da    PI: 6.6876
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G534300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.51e-2979163187
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                           rW++qe+laL+++r+em+ ++r+++lk+plWe+v++k+++ g++rs+k+C+ek+en+ k+yk++k+g+ +r  ++ + +++f++lea
  Sobic.001G534300.1.p  79 RWPRQETLALLKIRSEMDAAFREAALKGPLWEQVARKLEAMGYKRSAKKCREKFENVDKYYKRTKDGRAGR--GDGKAYRFFSELEA 163
                           8********************************************************************97..66667******985 PP

2trihelix108.73.7e-34483568187
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                           rW+k ev+aLi++r+e+e+r++++  k+plWe++s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpy++ql+a
  Sobic.001G534300.1.p 483 RWPKAEVHALIQLRTELETRYQDSGPKGPLWEDISSGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYYHQLDA 568
                           8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002476138IPR001005SANT/Myb domain
PROSITE profilePS500906.87678136IPR017877Myb-like domain
CDDcd122034.87E-2878143No hitNo description
PfamPF138379.3E-2178164No hitNo description
PROSITE profilePS500907.584476540IPR017877Myb-like domain
SMARTSM007178.3E-4480542IPR001005SANT/Myb domain
CDDcd122033.34E-32482547No hitNo description
Gene3DG3DSA:1.10.10.609.1E-4482539IPR009057Homeodomain-like
PfamPF138375.8E-24483569No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MQQPAMPPPF SPAAGTVSAA GQHATPISSR PPPEPQQQVD ELGGGSASAG SSFVVDHDGA  60
SAGGGGDDGE RNGPSGGNRW PRQETLALLK IRSEMDAAFR EAALKGPLWE QVARKLEAMG  120
YKRSAKKCRE KFENVDKYYK RTKDGRAGRG DGKAYRFFSE LEALHGASST AAPHPPVSVS  180
LAPTPVAMAL PPPATAALPG MVPAALHAEA QPPTQPRVVA AVPQPAPTAG TGSATATTAP  240
PAGAASDAAA ACMMTPGDVG FSSGSDGEDT EETGGGDGRK RKRDDGDGFG GSSSKMMRFF  300
EGLMRQVMER QEEMQRRFIE AMERREQDRM IREEAWRRQE VARLAREQDA LAQERAMAAS  360
RDAAVVSFIQ RVTGQTIPMP MPSSVAPPSA FITALTHTPP PLQPTPVASA APAQPPPPPA  420
HQLSPTTPKP HTTMPPMTAQ PQPHQAPSNP QGSKEIVVRA PPPAESQDTA GSGGGAPSPS  480
PSRWPKAEVH ALIQLRTELE TRYQDSGPKG PLWEDISSGM RRLGYNRSAK RCKEKWENIN  540
KYFKKVKESN KKRPEDSKTC PYYHQLDALY RSKALASLSS SGAAPAAAAP RPDQQAAAAP  600
PVTVLAAVPL SQTAPHHGNG NGNGCASRGS SDNGGGMQKQ QQASNGGGVA ARFSGAGGNG  660
VAATNKRDEG IIVMTKETTA APEETRPQPV SMNDSYVNDD AVDSDSISSM DDDDDEDDFD  720
DDEEGDVRGG GSGKMQYEIQ FQRQQQNNQS GGGGVRPNGS GGASAGPAAT ASGSFLTMVH  780
H*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSobic.001G534300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9516591e-132EU951659.1 Zea mays clone 988816 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465995.20.0trihelix transcription factor GTL1
TrEMBLA0A1B6QR320.0A0A1B6QR32_SORBI; Uncharacterized protein
STRINGSb01g049740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-44Trihelix family protein